DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts1

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_009302440.1 Gene:lzts1 ZFINID:ZDB-GENE-081104-431 Length:712 Species:Danio rerio

Alignment Length:729 Identity:164/730 (22%)
Similarity:268/730 (37%) Gaps:209/730 (29%)


  Fly   153 DGRGGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKPI 217
            |.||.|||:                      .|::|        ::.::.:|:  .:||.||||:
Zfish    90 DSRGRAAEQ----------------------LPLSG--------KLEKSIETA--LIRPTAFKPV 122

  Fly   218 -PFEPDYRIACQQQQQHQ-------------------QQLQLQQQQQQQQQQQQQQQLQL-QHQQ 261
             |     |.:....:.|.                   |..:|:..........:.....| .|..
Zfish   123 LP-----RSSSSSVETHNNLSTILGRRISPIDRLKDLQDPKLETNSGTFSDSGRNSMSSLPTHST 182

  Fly   262 QQQHQQQH---QHQHQQQHQSLQLPTEGGQ--AGGVAAERYGYG-STPSLAPLPTASAQKFGSTT 320
            ....|..:   ...|..:|..|...|:..|  .||:|......| |..|........:..|..|.
Zfish   183 SGSSQMDNLGTSTNHMARHGGLAQNTDTSQNPQGGIAGMNGNSGFSWMSSGTNGNMWSNGFSETN 247

  Fly   321 DLRHLAARRRNHRLLQRCSNE-----------DALTLDLLSTGSHDRPDGASSKSS-----GTVV 369
              |:..:...|.|.:...|..           .|..|.:|||  ..:.|...::..     .|..
Zfish   248 --RNCESTNGNTRSIGVLSESVAAAISLNREITAAALTVLST--EPKTDFTGNQEQLLEHRFTFS 308

  Fly   370 GSSDLTPSPS-----------DSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWE 423
            ..|...||||           :|.|.:||..|.:|:|||:.|:.::|..|....|:.::|:.|..
Zfish   309 EQSSKKPSPSEGCVRSPISMDESLIQQLEQKLLERESELAELQTSLEEKETDTCQLFEEKQRYCA 373

  Fly   424 HETQRLRLFYEGQQRECQLKLR-------KMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARD 481
            .|       .||.::.|..|||       |.:|||.||..||:|.|.|..|:|::|.:..|.|..
Zfish   374 EE-------MEGLKQRCSTKLRQVSQRAVKAQQLLQLQVIQLQQDKDRLQEEVDQLNRDRDTAES 431

  Fly   482 SSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHS--SNRSSS 544
            ..:..:.|.: |...||:::|.||:::|||:|||.||:::..:...|...||:||.|  .:|...
Zfish   432 RIRIYESQKN-LVPTLEETQWEVCQKSGEISLLKQQLRDSQTDAGNKLSEIVTLKASLKESRCKM 495

  Fly   545 SSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 609
            .......|.|:....|...:.:..:.:.|::..|....:::..:.:...:..:|.....:::|||
Zfish   496 EELEQKIKECEETLHQRSAEVEVSKNEFQRKKNEADLLREKVNKLETDIKGMKQDLHMAKEEQQQ 560

  Fly   610 QQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLK 674
            ....:.::::|    |.|||                :::.|.|......|....:|..|....|.
Zfish   561 LMAMRAKVEEQ----QLQLQ----------------ISQARMEAFGSGHAKSIAQEGTGACKTLN 605

  Fly   675 Q-----QLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLV 734
            .     .||||.:..:|.|                                              
Zfish   606 HNGATINLDNLQKEVEKLR---------------------------------------------- 624

  Fly   735 QRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQ 799
                   |:        |.||           :||......:.:.|::.|:.|||||:.||||||
Zfish   625 -------GE--------LKEE-----------KQKKHKMMNSFQQERQTWNKEKDKVIRYQKQLQ 663

  Fly   800 AHYIQMYQKLRCLD 813
            .:|:|||:|.|.|:
Zfish   664 YNYLQMYRKNRDLE 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 14/32 (44%)
lzts1XP_009302440.1 Fez1 449..680 CDD:284284 70/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17898151
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T598133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.