DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts2

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001006721.1 Gene:lzts2 XenbaseID:XB-GENE-1216151 Length:683 Species:Xenopus tropicalis

Alignment Length:745 Identity:164/746 (22%)
Similarity:277/746 (37%) Gaps:268/746 (36%)


  Fly   158 AAEEEAMQSLPATLP---------------QQHQQQQQRRTTPIAGGSRHQQQQQMGEAEQTSGN 207
            ::::.....||...|               :..:::......||:..|   ..:.:.|....:||
 Frog    83 SSQDPLFNGLPTKKPSTTTSGNNGNYVYVNEDFKEEWHEPRVPISPSS---DAEDIREERALNGN 144

  Fly   208 ----------------------FLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQ 250
                                  .::|.||||:           ..::....||...|:.......
 Frog   145 IRGPPPKLIPVSGKLEKNVEKTLIKPTAFKPV-----------VPKKRNSSLQYLVQRNGGPGLS 198

  Fly   251 QQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAG----------------GVAAERYGY 299
            :.|                        .||.|...|..||                |..::.   
 Frog   199 ESQ------------------------SSLNLLFNGNAAGIPEKHNLLSCRNSTHSGTMSDS--- 236

  Fly   300 GSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNE-DALTLDL--LSTGSH------- 354
            |.| ||:.|||.|.                       .||:: |.:::.:  ::..:|       
 Frog   237 GRT-SLSSLPTYST-----------------------NCSHQMDPVSVSMGHINLDNHTNINGYS 277

  Fly   355 DR-PDG------------ASSKSSGTVVGSSDLTPSPSDSG-------------ISELEAALKDR 393
            || |.|            :||||:|::.|..:  || ||||             |.|||..||||
 Frog   278 DRAPRGRTRPTNSDSGRSSSSKSTGSLSGRGN--PS-SDSGSCDRSPILSDEILIRELEEKLKDR 339

  Fly   394 DSELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQL 458
            :.||..|::.::.||..|.||.::|:...|.|.:.||.....:.::...|.::::|:|.||.|||
 Frog   340 EMELQQLKENLDENEAAICQVYEEKQKRCEQEMEELRQSCALKMKQAAQKAQRLQQVLQLQIFQL 404

  Fly   459 KQHKLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHL 523
            :|.|.:..|..::|.|:.:|........:::......:||:::|.||:::|||:|||.|||::..
 Frog   405 QQEKKKLQEDFSQLLQERELLEKRCASFEREQTEFGPRLEETKWEVCQKSGEISLLKQQLKDSQA 469

  Fly   524 EINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQ 588
            |:..|.:.|:.|:                                 .|.::...:||..::|.|:
 Frog   470 ELAQKSNEILLLR---------------------------------AQVREARSDLQISEEQVQE 501

  Fly   589 QQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKEL 653
            .|.....:..:.:..:.:.|:::.:.:.|:          :|...|..:|.|...:.:|.||   
 Frog   502 LQDTAHTKTLELEVCENELQRKKNEAELLR----------EKASKLDQEVAGLREAAVANLR--- 553

  Fly   654 SDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHV 718
            ..|.:.|| .|:|...|                        .|..|.|                 
 Frog   554 HGLCLCHE-KEDPFLLY------------------------ESDEAKA----------------- 576

  Fly   719 ATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEKRQ 783
                            ||...|..||.||.::.|.|..|:   :..:.:::.|.|    |.|:|.
 Frog   577 ----------------QRQNADNLQGLQQYVERLREALTS---ERRRYQEQADSF----EDERRI 618

  Fly   784 WSAEKDKVLGYQKQLQAHYIQMYQKLRCLD 813
            |..||:||:.||||||.:||||||:.|.|:
 Frog   619 WQEEKEKVIRYQKQLQHNYIQMYQQNRELE 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
lzts2NP_001006721.1 SMC_N <322..661 CDD:330553 111/439 (25%)
Fez1 446..651 CDD:311026 74/315 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17899911
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I4791
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.