DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and N4bp3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001029065.1 Gene:N4bp3 RGDID:1308356 Length:537 Species:Rattus norvegicus

Alignment Length:570 Identity:134/571 (23%)
Similarity:224/571 (39%) Gaps:106/571 (19%)


  Fly   118 GVGMGMGMGLQMRSKFQNIRQMFELSRSCVGGGGG----DG--RGGAAEEEAMQSLPATLPQQHQ 176
            |:.||....|..|..|..     |..|:.:.|..|    ||  |.|..:.|....|  .||::..
  Rat     9 GIAMGSVGSLLERQDFSP-----EELRAALAGSRGSRQPDGLLRKGLGQREFFSYL--HLPKKDG 66

  Fly   177 QQQQR--RTTPIAGGSRHQQQQQMGEAEQTS----GNF----LRPIAFKPIPFEPDYRIACQQQQ 231
            :..:|  |..|......:::..:.|:..:||    |.|    :||..|||       .::..:..
  Rat    67 KTAKRAPRNEPDYTTLYYREHPRAGDFSKTSLPERGRFDKCRIRPSVFKP-------PVSTGKGF 124

  Fly   232 QHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAGGVAAER 296
            ...|.|...:.|:..:.......|.. |.......:..|.:.|..| :|.| .|||....::...
  Rat   125 LSMQSLAAHKGQKLWRSNGSLHTLAC-HPPLSPGPRASQARAQLLH-ALSL-DEGGPEPSLSDSS 186

  Fly   297 YG--YGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDG 359
            .|  :|.:|...|.|.:|     |...:.||.                         ||.||. .
  Rat   187 SGGSFGRSPGTGPSPFSS-----SLGHINHLG-------------------------GSLDRA-S 220

  Fly   360 ASSKSSGTVVGSSDLTPSPSDSGIS----ELEAALKDRDSELSYLRQAMEHNEKVIF-QVQKDKE 419
            .|.|.||.:...|.|...|.....|    |..|.|.|...||.  |...:.:....| ||.::::
  Rat   221 RSPKESGPLAVLSCLPEPPPPYEFSCPTTEEVAVLPDTCEELK--RDLGDQDVSNPFTQVLEERQ 283

  Fly   420 VYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQ 484
            ..|..|.:||   |..:..|...|..:.|:.|.||.|..:|.:.|..::: |.||.| .....:.
  Rat   284 RLWLSELKRL---YVDRLHEVAQKAERSERNLQLQLFMAQQEQRRLRKEL-RAQQGL-APEPRTS 343

  Fly   485 GLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSN 549
            |...:.|......|::.|.||::..||:|||.||:||..|:..|...|.|||.....|.:.:.:.
  Rat   344 GPPMEADPNARPEEEARWEVCQKTAEISLLKQQLREAQAELAQKLAEIFSLKTQLRGSRAQAQAQ 408

  Fly   550 SNK----------------------SCDTNTSQSQ------PKQQAKEEQQQQQHPELQQQQQQQ 586
            ..:                      ||:|:..:|:      ...:|:|..:|.:...||::.:.|
  Rat   409 DAELARLREAVRSLQEQAPREEAPGSCETDDCKSRGLLGEAGGNEAREGAEQLRAELLQERLRGQ 473

  Fly   587 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKD 636
            :|..:.:|::|..|:::::..:.|::.|......::.:|...|::..|::
  Rat   474 EQALRFEQERQTWQEEKERVLRYQREIQGSYMDMYRRNQALEQELRVLRE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 11/32 (34%)
N4bp3NP_001029065.1 Fez1 361..518 CDD:284284 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.