DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and Lzts3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_008760369.1 Gene:Lzts3 RGDID:631327 Length:766 Species:Rattus norvegicus

Alignment Length:893 Identity:187/894 (21%)
Similarity:321/894 (36%) Gaps:261/894 (29%)


  Fly     2 SAATHMAMPAHAV-----VPPPGTPPVLGGSGCSN---------LSLPSGKRGHKRSVSLENNAP 52
            |..:||| ||...     :..|..|.:.|...|.:         :..|||       :.:.....
  Rat    43 SRESHMA-PADLASEGPKLEDPPAPHLFGKGYCVSPLTSEIHYWIQCPSG-------LIMAKLET 99

  Fly    53 LALRSTPSMG--------QSSLG--SPLLQFGQAAPGQGHSQGFHTGTLKSRQEQRRLSQKF--- 104
            |.:|:.|...        .:.||  .|.|..|....|..|:|.|...::.:|.........|   
  Rat   100 LPVRADPGRDPLLAFAPRPAELGPPDPRLTMGSVGGGVTHAQEFPMKSVGTRTGGGGSQGSFPGP 164

  Fly   105 ---GSHSNLDDEGVG--IGVGMGMGMGLQMRSKFQNIRQMFELSRSCVGGGGGDGRGGAAEEEAM 164
               ||.:|.:..|.|  ......:...|.:..:.:. ....::..:.||..||....|.:::   
  Rat   165 RSSGSGTNRERPGPGRYPSEDKVLANSLYLNGELRG-SDHTDVCGNVVGSSGGSSSSGGSDK--- 225

  Fly   165 QSLPATLPQQHQQQQ---QRRTTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKPIPFEPDYRIA 226
                  .|.|:::..   :..||             .|:.:|.|...:||.||||:         
  Rat   226 ------APPQYREPNHPPKLLTT-------------SGKLDQCSEPLVRPSAFKPV--------- 262

  Fly   227 CQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAGG 291
             ..:..|..| .|...|.....:.:|....|:...:               :|..:...||..||
  Rat   263 -VPKNFHSMQ-NLCPPQTNGTPEGRQGPAGLKGGLE---------------KSRTMTPAGGSGGG 310

  Fly   292 VAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSN--------------ED 342
            ..::    ....||..|||.      |::..:|||....:...:.|...              :|
  Rat   311 GLSD----SGRNSLTSLPTY------SSSYSQHLAPLSASTSHINRIGTPGYSSGGGGGGSGYQD 365

  Fly   343 ALTLDLLSTGSHDRPDGASSK------------SSGTVVGSSDLTPSPSDSGISELEAALKDRDS 395
            ..|.|   :|......|:||.            .:|.:..::...|||| :.|.|||..|.:::.
  Rat   366 LGTSD---SGRASSKSGSSSSMGRSGHLGSGEGGNGGLPFAACSPPSPS-ALIQELEERLWEKEQ 426

  Fly   396 ELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQ 460
            |::.||:::|.:|..:.||.::::..||.|...||....|:.::...:.::.:|.|.||..:|:|
  Rat   427 EVAALRRSLEQSEAAVAQVLEERQKAWERELAELRQGCSGKLQQVARRAQRAQQGLQLQVLRLQQ 491

  Fly   461 HKLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEI 525
            .|.:..|:..:|.:|.:...|.....|::......::|:::|.||::.|||:|||.|||::..::
  Rat   492 DKKQLQEEAAQLIRQREELEDKVAACQKEQADFLPRMEETKWEVCQKAGEISLLKQQLKDSQADV 556

  Fly   526 NMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQ 590
            :.|...||.|:                                 .|.::....|:::::|     
  Rat   557 SQKLSEIVGLR---------------------------------SQLREGRASLREKEEQ----- 583

  Fly   591 QQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSD 655
                                                    :::|:|    :..|:.|.|  |||:
  Rat   584 ----------------------------------------LLSLRD----SFGSKQASL--ELSE 602

  Fly   656 LAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPA--AHV 718
                   ||.|               ..|.|      .:.:|..:..|...:|......|  ...
  Rat   603 -------GELP---------------PACLK------PALTPVDLVEPQEALASCESDEAKMRRQ 639

  Fly   719 ATPSCAQELPKLDVLVQRLQLDQG--QGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEK 781
            |..:.|..|..:|.     ::|.|  .||:    .|..|......::|..|:..:....:...|:
  Rat   640 AGVAAAASLVSVDG-----EVDAGGEGGTR----ALRREVGRLQAELAAERRARERQGASFAEER 695

  Fly   782 RQWSAEKDKVLGYQKQLQAHYIQMYQK----LRCLDSAGAAVGQVEAT 825
            |.|..||:||:.||||||..|::|||:    .|.|...|||.|....|
  Rat   696 RVWLEEKEKVIEYQKQLQLSYVEMYQRNQQLERRLRERGAAGGSSTPT 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
Lzts3XP_008760369.1 DUF4200 423..525 CDD:290574 25/102 (25%)
Fez1 531..730 CDD:284284 66/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17896236
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T1089283
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.