DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and Lzts3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_922936.3 Gene:Lzts3 MGIID:2656976 Length:700 Species:Mus musculus

Alignment Length:864 Identity:184/865 (21%)
Similarity:309/865 (36%) Gaps:258/865 (30%)


  Fly    18 PGTPPVLGGSGCSNLSLPSGKRGHKRSVSLENNAPLALRSTPSMG--------QSSLG--SPLLQ 72
            |..|.:.|       ..|||       :.:.....|.:|:.|...        .|.||  .|.|.
Mouse    16 PPAPHLFG-------KCPSG-------LIMAKLETLPVRADPGRDPLLAFAPRPSELGPPDPRLT 66

  Fly    73 FGQAAPGQGHSQGFHTGTLKSRQEQRRLSQKF------GSHSNLDDEGVGIGVGMGMGMGLQMRS 131
            .|....|..|:|.|...::.:|.........|      ||.:|.:..|........:...|.:..
Mouse    67 MGSVGSGVTHAQEFPMKSVGTRTGGGGNQGSFPGPRSGGSGANRERPGRYPSEDKVLANSLYLNG 131

  Fly   132 KFQNIRQMFELSRSCVGGGGGDGRGGAAEEEAMQSLPATLPQQHQQQQ---QRRTTPIAGGSRHQ 193
            :.:. ....::..:.||..||....|.:::         .|.|:::..   :..||         
Mouse   132 ELRG-SDHTDVCGNVVGSSGGSSSSGGSDK---------APPQYREPNHPPKLLTT--------- 177

  Fly   194 QQQQMGEAEQTSGNFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQ 258
                .|:.:|.|...:||.||||:          ..:..|..| .|...|.....:.:|....|:
Mouse   178 ----SGKLDQCSEPLVRPSAFKPV----------VPKNFHSMQ-NLCPPQTNGTPEGRQGPAGLK 227

  Fly   259 HQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLR 323
            ....               :|..:...||..||::.     ....||..|||.      |::..:
Mouse   228 GGLD---------------KSRTMTPAGGSGGGLSD-----SGRNSLTSLPTY------SSSYSQ 266

  Fly   324 HLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDG-----------ASSKSSGTV-------VG 370
            |||....:...:.|.....      .|:||.....|           |||||..:.       :|
Mouse   267 HLAPLSASTSHINRIGTAG------YSSGSSGGGSGYQDLGTSDSGRASSKSGSSSSMGRSGHLG 325

  Fly   371 SSD-----------LTPSPSDSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEH 424
            |.:           ..|||| :.|.|||..|.:::.|::.||:::|.:|..:.||.::::..||.
Mouse   326 SGEGGNGGLPFAACSPPSPS-ALIQELEERLWEKEQEVAALRRSLEQSEAAVAQVLEERQKAWER 389

  Fly   425 ETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQGLQQQ 489
            |...||....|:.::...:.::.:|.|.||..:|:|.|.:..|:..:|.:|.:...|.....|::
Mouse   390 ELAELRQGCSGKLQQVARRAQRAQQGLQLQVLRLQQDKKQLQEEAAQLIRQREELEDKVAVCQKE 454

  Fly   490 VDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSC 554
            ......::|:::|.||::.|||:|||.|||::..:::.|...||.|:                  
Mouse   455 QADFLPRMEETKWEVCQKAGEISLLKQQLKDSQADVSQKLSEIVGLR------------------ 501

  Fly   555 DTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQ 619
                           .|.::....|:::::|                                  
Mouse   502 ---------------SQLREGRASLREKEEQ---------------------------------- 517

  Fly   620 QHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEIC 684
                       :::|:|    :..|:.|.|  |||:       ||.|               ..|
Mouse   518 -----------LLSLRD----SFGSKQASL--ELSE-------GELP---------------PAC 543

  Fly   685 QKTRKYTTTSASPTAVASPAAQVAPPAPSPA--AHVATPSCAQELPKLDVLVQRLQLDQGQGTQQ 747
            .|      .:.:|..:..|...:|......|  ...|..:.|..|..:|..|:.    .|:|..:
Mouse   544 LK------PALTPVDLVEPQEALASCESDEAKMRRQAGVAAAASLVSVDGEVEA----GGEGGTR 598

  Fly   748 TLDTLIE--ESTTYAEDIAKLRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQAHYIQMYQK-- 808
            .|...:.  ::...||..|:.||     ..:...|:|.|..||:||:.||||||..|::|||:  
Mouse   599 ALRREVGRLQAELAAERRARERQ-----GASFAEERRVWLEEKEKVIEYQKQLQLSYVEMYQRNQ 658

  Fly   809 --LRCLDSAGAAVGQVEAT 825
              .|.|...|||.|....|
Mouse   659 QLERRLRERGAAGGSSTPT 677

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
Lzts3NP_922936.3 Fez1 465..664 CDD:284284 67/320 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17897342
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T1085742
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.