DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and N4BP3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_055926.1 Gene:N4BP3 HGNCID:29852 Length:544 Species:Homo sapiens

Alignment Length:593 Identity:128/594 (22%)
Similarity:222/594 (37%) Gaps:145/594 (24%)


  Fly   118 GVGMGMGMGLQMRSKFQNIRQMFELSRSCVGGGGG----DG--RGGAAEEEAMQSLPATLPQQHQ 176
            |:.||....|..|..|..     |..|:.:.|..|    ||  |.|..:.|.:..|  .||::..
Human     9 GIAMGSVGSLLERQDFSP-----EELRAALAGSRGSRQPDGLLRKGLGQREFLSYL--HLPKKDS 66

  Fly   177 QQQQR-----RTTPIAGGS-RHQQQQQMGEAEQTS----GNF----LRPIAFKPIPFEPDYRIAC 227
            :..:.     |..|....: .:::..:.|:..:||    |.|    :||..|||........::.
Human    67 KSTKNTKRAPRNEPADYATLYYREHSRAGDFSKTSLPERGRFDKCRIRPSVFKPTAGNGKGFLSM 131

  Fly   228 QQQQQHQQQLQLQQQQQ----------QQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQL 282
            |....|:.|...:....          ....:..|.:.||.|                   :|.|
Human   132 QSLASHKGQKLWRSNGSLHTLACHPPLSPGPRASQARAQLLH-------------------ALSL 177

  Fly   283 PTEGG----------QAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQR 337
             .|||          .:||      .:|.:|...|.|.:|     |...|.||.           
Human   178 -DEGGPEPEPSLSDSSSGG------SFGRSPGTGPSPFSS-----SLGHLNHLG----------- 219

  Fly   338 CSNEDALTLDLLSTGSHDRPDGASSKSSGTVVGSSDLTPSP----SDSGISELEAALKDRDSELS 398
                          ||.||......::....|.|....|.|    |.|...|:.|.|.:...|  
Human   220 --------------GSLDRASQGPKEAGPPAVLSCLPEPPPPYEFSCSSAEEMGAVLPETCEE-- 268

  Fly   399 YLRQAM--EHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQH 461
             |::.:  |.......||.::::..|..|.:||   |..:..|...|..:.|:.|.||.|..:|.
Human   269 -LKRGLGDEDGSNPFTQVLEERQRLWLAELKRL---YVERLHEVTQKAERSERNLQLQLFMAQQE 329

  Fly   462 KLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEIN 526
            :.|..::: |.||.| .....:.|...:.|......|::.|.||::..||:|||.||:||..|:.
Human   330 QRRLRKEL-RAQQGL-APEPRAPGTLPEADPSARPEEEARWEVCQKTAEISLLKQQLREAQAELA 392

  Fly   527 MKDHAIVSLKHSSNRSSSSSNSNSNK----------------------SCDTNTSQSQ------P 563
            .|...|.|||.....|.:.:.:...:                      ||:|:..:|:      .
Human   393 QKLAEIFSLKTQLRGSRAQAQAQDAELVRLREAVRSLQEQAPREEAPGSCETDDCKSRGLLGEAG 457

  Fly   564 KQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQL 628
            ..:|::..:|.:...||::.:.|:|..:.:|:::..|:::::..:.|::.|......::.:|...
Human   458 GSEARDSAEQLRAELLQERLRGQEQALRFEQERRTWQEEKERVLRYQREIQGGYMDMYRRNQALE 522

  Fly   629 QKIITLKD 636
            |::..|::
Human   523 QELRALRE 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 11/32 (34%)
N4BP3NP_055926.1 Fez1 368..525 CDD:284284 35/157 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.