DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and Lzts2

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001123997.1 Gene:Lzts2 MGIID:2385095 Length:671 Species:Mus musculus

Alignment Length:698 Identity:146/699 (21%)
Similarity:252/699 (36%) Gaps:229/699 (33%)


  Fly   172 PQQHQQQQQR------RTTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKPI-------PFEPDY 223
            |::||.....      :..|::|......::.:          :||.||||:       |..|.:
Mouse   110 PREHQAHNAHLRGPPPKLIPVSGKLEKNMEKIL----------IRPTAFKPVLPKPRGAPSLPGF 164

  Fly   224 ---RIA-CQQQQQHQQQL---QLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQ 281
               |.| ....|....||   ...............:.|.|                        
Mouse   165 LGPRAAGLSGSQGSLTQLFGGPASSSSSSSSSSAADKPLAL------------------------ 205

  Fly   282 LPTEGGQAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDL--RHLAARRRNHRLLQRCSNEDAL 344
                .|.|.|..:.........||:.|||.|......||:.  .||.:.......|...:..   
Mouse   206 ----SGWASGCPSGTLSDSGRNSLSSLPTYSTGGAEPTTNSPGGHLPSHGPGRGALPGPARG--- 263

  Fly   345 TLDLLSTG-SH-DRPDGASSKSSGTV----------------VGSSD---------LTPSPSDSG 382
                :.|| || |....:||||:|::                .|||.         ..|.|||..
Mouse   264 ----VPTGPSHSDSGRSSSSKSTGSLGGRVAGGLLGSGARASPGSSSGGDRSPPPPPPPPPSDEA 324

  Fly   383 ISE--LEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEG-----QQREC 440
            :..  ||..|:||::||..||.:|:.:|..:.|....::..|..|        .|     |.::.
Mouse   325 LLHCVLEGKLRDREAELQQLRDSMDESEATVCQAFGARQRRWPRE--------RGEDCAAQAQQA 381

  Fly   441 QLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVC 505
            ..::::.:|||.||.|||:|.|.:..:...:|.|:.:.........:::...|..:||:::|.||
Mouse   382 TQRVQRAQQLLQLQVFQLQQEKRQLQDDFAQLLQEREQLERRCATFEREQRELGPRLEETKWEVC 446

  Fly   506 ERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEE 570
            :::|||:|||.||||:..|:..|...:|:|:.:...:.::                         
Mouse   447 QKSGEISLLKQQLKESQAELVQKGSELVALRVALREARAT------------------------- 486

  Fly   571 QQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLK 635
                    |:..:.:.:..|:..:.::|:.:...|:.|:.:|:.::|:::               
Mouse   487 --------LRVSEGRARGLQEAARAREQELEACSQELQRYRQEAERLREK--------------- 528

  Fly   636 DQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAV 700
               .|.|.:|.:.||.                                                 
Mouse   529 ---AGHLDAEASGLRD------------------------------------------------- 541

  Fly   701 ASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAK 765
                    ||.| ||  ...|....|..  :..|||.....|...:..::.|.:|       :.:
Mouse   542 --------PPVP-PA--TTDPFLLAESD--EAKVQRAAAGAGGSLRAQVERLRQE-------LQR 586

  Fly   766 LRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCLD 813
            .:::.|:.|.:.|.|:..|.|||::|:.||||||.:|||||::.|.|:
Mouse   587 EQRRGDEQRDSFEGERLAWQAEKEQVIRYQKQLQHNYIQMYRRNRQLE 634

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 13/32 (41%)
Lzts2NP_001123997.1 Required for centrosomal localization. {ECO:0000250} 1..333 53/268 (20%)
Fez1 441..637 CDD:284284 64/315 (20%)
Sufficient for interaction with CTNNB1. {ECO:0000250} 449..671 61/307 (20%)
Sufficient for interaction with KATNB1 and for inhibition of katanin-mediated microtubule severing. {ECO:0000250} 452..671 59/304 (19%)
DUF4763 504..>620 CDD:292582 37/203 (18%)
Nuclear export signal. {ECO:0000255|HAMAP-Rule:MF_03026} 633..642 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17898850
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_136019
Panther 1 1.100 LDO PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.