DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and N4bp3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_666086.2 Gene:N4bp3 MGIID:2442218 Length:537 Species:Mus musculus

Alignment Length:595 Identity:136/596 (23%)
Similarity:223/596 (37%) Gaps:141/596 (24%)


  Fly   118 GVGMGMGMGLQMRSKFQNIRQMFELSRSCVGGGGG----DG--RGGAAEEEAMQSLPATLPQQHQ 176
            |:.||....|..|..|..     |..|:.:.|..|    ||  |.|..:.|....|  .||::..
Mouse     9 GIAMGSVGSLLERQDFSP-----EELRAALAGSRGSRQPDGLLRKGLGQREFFSYL--HLPKKDG 66

  Fly   177 QQQQR--RTTPIAGGSRHQQQQQMGEAEQTS----GNF----LRPIAFKPIPFEPDYRIACQQQQ 231
            :..:|  |..|......:::..:.|:..:||    |.|    :||..|||       .:...:..
Mouse    67 KTTKRAPRNEPDYATLYYREHPRAGDFSKTSLPERGRFDKCRIRPSVFKP-------PVGSGKGF 124

  Fly   232 QHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQAGGVAAER 296
            ...|.|...:.|:..:.......|.. |.......:..|.:.|..| :|.| .|||....::...
Mouse   125 LSMQSLAAHKGQKLWRSNGSLHTLAC-HPPLSPGPRASQARAQLLH-ALSL-DEGGPEPSLSDSS 186

  Fly   297 YG--YGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDG 359
            .|  :|.:|...|.|.:|     |...:.||.                         ||.||.. 
Mouse   187 SGGSFGRSPGTGPSPFSS-----SLGHINHLG-------------------------GSLDRAP- 220

  Fly   360 ASSKSSGTVVGSSDLTPSPSDSGIS---------------ELEAALKDRDSELSYLRQAMEHNEK 409
            .|.|.||.:...|.|...|.....|               ||:..|.|:|...|:.         
Mouse   221 RSPKESGPLAVLSCLPEPPPPYEFSCPTTEEVAVLPEAREELKRDLGDQDVSNSFT--------- 276

  Fly   410 VIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQ 474
               ||.::::..|..|.:||   |..:..|...|..:.|:.|.||.|..:|.:.|..::: |.||
Mouse   277 ---QVLEERQRLWLSELKRL---YVERLHEVAQKAERSERNLQLQLFMAQQEQRRLRKEL-RAQQ 334

  Fly   475 QLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSS 539
            .| .....:.|...:.|......|::.|.||::..||:|||.||:||..|:..|...|.|||...
Mouse   335 GL-APEPRTSGSSMEADPNARPEEEARWEVCQKTAEISLLKQQLREAQAELAQKLAEIFSLKTQL 398

  Fly   540 NRSSSSSNSNSNK----------------------SCDTNTSQSQ------PKQQAKEEQQQQQH 576
            ..|.:.:.:...:                      ||:|:..:|:      ...:|:|..:|.:.
Mouse   399 RGSRAQAQAQDAELARLREAVHSLQEQAPREEAPGSCETDDCKSRGLLGEAGGSEAREGAEQLRA 463

  Fly   577 PELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGA 641
            ..||::.:.|:|..:.:|::|..|:::::..:.|::.|......::.:|               |
Mouse   464 ELLQERLRGQEQALRFEQERQTWQEEKERVLRYQREIQGSYMDMYRRNQ---------------A 513

  Fly   642 LTSELAKLRK 651
            |..||..||:
Mouse   514 LEHELRLLRE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 11/32 (34%)
N4bp3NP_666086.2 Fez1 361..518 CDD:284284 39/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.