DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and Lzts1

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001357900.1 Gene:Lzts1 MGIID:2684762 Length:599 Species:Mus musculus

Alignment Length:796 Identity:158/797 (20%)
Similarity:253/797 (32%) Gaps:300/797 (38%)


  Fly    81 GHSQGFHTGTLKSRQEQRRLSQKFGSHSNLDDEGVGIGVGMGMGMGLQMRSKFQNIRQMF--ELS 143
            |||  ||:...::.|.:.|.|......:...|..:..|.....|.| :..||.......|  ::|
Mouse    10 GHS--FHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGRG-KSSSKMGKSEDFFYIKVS 71

  Fly   144 RSCVGGGGGD----GRGGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQMGEAEQT 204
            :...|....|    ..|....:..:...|||.|:......|...:...|.               
Mouse    72 QKARGSHRPDYTALSSGDIGGQTGVDFDPATPPKLMPFSNQLEMSSDKGA--------------- 121

  Fly   205 SGNFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQH 269
                :||.||||:                                       |.......|....
Mouse   122 ----VRPTAFKPV---------------------------------------LPRSGAILHSSPE 143

  Fly   270 QHQHQQQHQSLQLPTE----GGQAGGVAAE--RYGYGSTPS--------LAPL--PTASAQKFGS 318
            ...||........|.|    .|...|..::  |....|.|:        |.||  |.....:||.
Mouse   144 STSHQLHPMPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTTSSYQLDPLVTPVGPTSRFGG 208

  Fly   319 TTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDGASSKSSGTVVGSSDLTPSPSDSG- 382
            :.           |.:.|....:|:..:.|          .|.|.|.|   ||....|..:|.| 
Mouse   209 SA-----------HNITQGIILQDSNMMSL----------KALSFSDG---GSKLAHPGKADKGA 249

  Fly   383 -------------ISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYE 434
                         |.|||..|..|::.|..|:::.:..|....|.       :|...:|.|    
Mouse   250 SCVRSPLSTDECTIQELEQKLLQRETALQKLQRSFDEKEFASGQT-------FEERPRRTR---- 303

  Fly   435 GQQREC----------QLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQGLQQQ 489
             .:.||          ..|.::.:|:|.||..||:|.|.:..:::..|.::.||.....:..:::
Mouse   304 -DELECLEPKSKLKPPSQKSQRTQQVLQLQVLQLQQEKRQLRQELESLMKEQDLLETKLRSYERE 367

  Fly   490 VDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSC 554
            .......||:::|.||:::|||:|||.||||:.||:|.|...|:||                   
Mouse   368 KTNFAPALEETQWEVCQKSGEISLLKQQLKESQLEVNTKASEILSL------------------- 413

  Fly   555 DTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQ 619
                     |.|.|:.:.:....||:.|..:...:.:..:.:..:.:.|:::.:.:         
Mouse   414 ---------KAQLKDTRGKLDGMELKTQDLESALRTKGLELEVCENELQRKKNEAE--------- 460

  Fly   620 QHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEIC 684
                          |..:.:..|..||.:||.:    |..|                        
Mouse   461 --------------LLREKVNLLEQELMELRAQ----AALH------------------------ 483

  Fly   685 QKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLVQRLQLDQGQGTQQTL 749
                               .|.:.||                               |.|     
Mouse   484 -------------------PAPLGPP-------------------------------GVG----- 493

  Fly   750 DTLIEESTTYAEDIAKLRQKLDDFRLNLELEKRQ---------------WSAEKDKVLGYQKQLQ 799
                   .|::|||..|:::||..|..|: |:||               |..||:||:.||:|||
Mouse   494 -------LTFSEDIPALQRELDRLRAELK-EERQGHDQMSSGFQHERLVWKEEKEKVIQYQRQLQ 550

  Fly   800 AHYIQMYQKLRCLDSA 815
            ..|:.|||:.:.|:.|
Mouse   551 QSYLAMYQRNQRLEKA 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
Lzts1NP_001357900.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17896600
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.