DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and F35B3.7

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_510753.3 Gene:F35B3.7 WormBaseID:WBGene00018033 Length:578 Species:Caenorhabditis elegans

Alignment Length:434 Identity:87/435 (20%)
Similarity:146/435 (34%) Gaps:111/435 (26%)


  Fly   136 IRQMFELSRSCVGGGGGDGR--GGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQM 198
            |.::|...|..:..|..:.|  ..:.|:..:...|:|..:|.:.|....|..|...|.....|::
 Worm   179 IEEIFAPLRDTIKEGIEEARHLSSSPEKIKINHTPSTRLEQWKAQLNSTTPRIRDSSAPATVQRL 243

  Fly   199 GEAEQTSG-NFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQ 262
            ....||:. |..||:                                ...|........:.|:..
 Worm   244 TIKPQTTQLNIPRPV--------------------------------HSTQSASNALTTMDHRTL 276

  Fly   263 QQHQQQHQHQHQQQHQSLQLPTEGGQAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAA 327
            :....:.:....|...|.....:......|.:.||.:.......|:.......|.:..|....:.
 Worm   277 RDVSSRRRSGTWQPFSSNTYNADRPPIDFVTSTRYSHQEATIFRPIAHRPKPDFINHNDSNRRSF 341

  Fly   328 RRRNHRLLQRCSNEDALTLDLL-----------------STGSHD------RPD----------G 359
            ||.:..|.....:.:....|||                 ||.|:.      .|:          .
 Worm   342 RRVDSILHSELKDSNGSLSDLLMMYQAKDTPREMNASIRSTASNSSSFPYFSPEQINQQKNVLTT 406

  Fly   360 ASSKSSGTVVGSSDLTPSPSDSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEH 424
            .||.|||..|     |||||||||.:.|..::|::.||..:|..||.||::|.:|.:|||..|:.
 Worm   407 LSSSSSGIHV-----TPSPSDSGIIDYENLIRDKELELQEIRNTMEQNEEIIIKVYQDKERAWKT 466

  Fly   425 ETQRLRLFYEGQQR----------ECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLA 479
            |.:.|:......::          .||.:...|...:...|    :.|.|...:..:|:::||..
 Worm   467 ELEGLKCRVSAAEKGEKALREQLSNCQRQNTAMSSCMRTVQ----EEKTRLMGKCIQLERELDNL 527

  Fly   480 RDSS------------------------QGLQQQVDALRHQLED 499
            .:.|                        |.|:|:|..|:..::|
 Worm   528 HNVSLKSAGCPNCSVASNIEEKDLRREVQDLRQEVANLKQVVDD 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 5/15 (33%)
F35B3.7NP_510753.3 SMC_prok_B <423..565 CDD:274008 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17886270
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T474134
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.