DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and LZTS1

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001349813.1 Gene:LZTS1 HGNCID:13861 Length:596 Species:Homo sapiens

Alignment Length:789 Identity:158/790 (20%)
Similarity:266/790 (34%) Gaps:271/790 (34%)


  Fly    81 GHSQGFHTGTLKSRQEQRRLSQKFGSHSNLDDEGVGIGVGMGMGMGLQMRSKFQNIRQMF--ELS 143
            |||  ||:...::.|.:.|.|......:...|..:..|.....|.| :..||.......|  ::|
Human    10 GHS--FHSKHCRASQYKLRKSSHLKKLNRYSDGLLRFGFSQDSGHG-KSSSKMGKSEDFFYIKVS 71

  Fly   144 RSCVGG--------GGGDGRGGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQMGE 200
            :...|.        ..||..|.|..:....:.|..:|                   ...|.:||.
Human    72 QKARGSHHPDYTALSSGDLGGQAGVDFDPSTPPKLMP-------------------FSNQLEMGS 117

  Fly   201 AEQTSGNFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQH 265
            .:    ..:||.||||:                                       |.......|
Human   118 EK----GAVRPTAFKPV---------------------------------------LPRSGAILH 139

  Fly   266 QQQHQHQHQQQHQSLQLPTE----GGQAGGVAAE--RYGYGSTPS--------LAPL--PTASAQ 314
            .......||........|.|    .|...|..::  |....|.|:        |.||  |.....
Human   140 SSPESASHQLHPAPPDKPKEQELKPGLCSGALSDSGRNSMSSLPTHSTSSSYQLDPLVTPVGPTS 204

  Fly   315 KFGSTTDLRHLAARRRNHRLLQRCSNEDA--LTLDLLSTGSHDRPDGASSKSSGTVVGSSDLTP- 376
            :||.:.           |.:.|....:|:  ::|..||........|.|:|        :|..| 
Human   205 RFGGSA-----------HNITQGIVLQDSNMMSLKALSFSDGGSKLGHSNK--------ADKGPS 250

  Fly   377 ------SPSDSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEG 435
                  |..:..|.|||..|.:|:..|..|:::.|..|..       ..:.:|...:|.|...||
Human   251 CVRSPISTDECSIQELEQKLLEREGALQKLQRSFEEKELA-------SSLAYEERPRRCRDELEG 308

  Fly   436 QQ-------RECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQGLQQQVDAL 493
            .:       ::...|.::.:|:|.||..||:|.|.:..:::..|.::.||.....:..:::..:.
Human   309 PEPKGGNKLKQASQKSQRAQQVLHLQVLQLQQEKRQLRQELESLMKEQDLLETKLRSYEREKTSF 373

  Fly   494 RHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNT 558
            ...||:::|.||:::|||:|||.||||:..|:|.|...|:.|                       
Human   374 GPALEETQWEVCQKSGEISLLKQQLKESQTEVNAKASEILGL----------------------- 415

  Fly   559 SQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQP 623
                 |.|.|:.:.:.:..||:.|..:...:.:..:.:..:.:.|:::.:               
Human   416 -----KAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNE--------------- 460

  Fly   624 DQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTR 688
                                   |:|.:|..:|                |:|:|..|.       
Human   461 -----------------------AELLREKVNL----------------LEQELQELR------- 479

  Fly   689 KYTTTSASPTAVASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLI 753
                      |.|:.|..:.|           |:..:::|.|...::||:.:           |.
Human   480 ----------AQAALARDMGP-----------PTFPEDVPALQRELERLRAE-----------LR 512

  Fly   754 EESTTYAEDIAKLRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCLDSA--- 815
            ||           ||..|......:.|:..|..||:||:.||||||..|:.|||:.:.|:.|   
Human   513 EE-----------RQGHDQMSSGFQHERLVWKEEKEKVIQYQKQLQQSYVAMYQRNQRLEKALQQ 566

  Fly   816 ---GAAVGQ 821
               |.:.|:
Human   567 LARGDSAGE 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
LZTS1NP_001349813.1 SMC_N <235..>513 CDD:330553 78/414 (19%)
Fez1 380..564 CDD:311026 66/316 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17897815
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.