DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and n4bp3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_021336943.1 Gene:n4bp3 ZFINID:ZDB-GENE-141216-2 Length:463 Species:Danio rerio

Alignment Length:401 Identity:95/402 (24%)
Similarity:168/402 (42%) Gaps:95/402 (24%)


  Fly   298 GYGSTPSLAPLPTASAQKFGS-TTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDGAS 361
            |:.|..||.|.........|. :..:.|:     ||                  .||.||....|
Zfish    70 GHNSMNSLPPYKPPFRPHLGQISASMGHI-----NH------------------IGSLDRTSLGS 111

  Fly   362 SKSSGTVV----------------GSS-----DLTPSPSDSGISELEAALKDRDSELSYLRQAME 405
            ..::.||.                ||.     :|:.|..|. |.:||..|::::.||..:|:.::
Zfish   112 KGAASTVTEVSCQSMATLNRLQCYGSEAPPPYELSQSLEDV-IRDLEERLQEKEHELRQMRRNLD 175

  Fly   406 HNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVN 470
            .:|..|.||.:.|:..||.|...|:..|..:.|:...:.::.::.|.||.::.:|.:       |
Zfish   176 ESEDAIAQVFEGKQRLWEKEVTELKNLYTAKLRQISQQAQRSQRNLQLQLYKAQQER-------N 233

  Fly   471 RLQQQLDLARDSSQGLQQQVDA-----LRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDH 530
            |||.:|:..|...|.|:.|..|     :..|||:::|.||:::|||:|||.||:::..|:..|..
Zfish   234 RLQDELESVRLECQKLKSQSPAAQSQNINPQLEETQWEVCQKSGEISLLKQQLRDSQAEVTQKLS 298

  Fly   531 AIVSLK---HSSNRSSSSSNS----------NSNKSC------DTNTSQSQPKQQAKEEQQQQQH 576
            .|..||   |.:.....|.:|          .:.:.|      ||.:.....:.......:::..
Zfish   299 EIFHLKTQLHETRNQMRSKDSQIDSLQTAVQGARRKCTMPAFEDTRSDMDTGETGGSSATEERLR 363

  Fly   577 PELQQQQQQQQQQQQQQQQQQQQQQQQQQQ--QQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVI 639
            .||..:::|.:.|....:.:::..|.::::  :.|::.|...|:..||.:               
Zfish   364 AELLLERRQNEAQTSAFESERKTWQNEKEKVIRYQKELQASYLEMYHQNE--------------- 413

  Fly   640 GALTSELAKLR 650
             ||..|||.||
Zfish   414 -ALERELAVLR 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 16/37 (43%)
n4bp3XP_021336943.1 SMC_N <155..>326 CDD:330553 53/178 (30%)
Fez1 268..419 CDD:311026 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.