DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and n4bp3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_002936896.2 Gene:n4bp3 XenbaseID:XB-GENE-988982 Length:577 Species:Xenopus tropicalis

Alignment Length:699 Identity:138/700 (20%)
Similarity:226/700 (32%) Gaps:268/700 (38%)


  Fly   214 FKPIPFEPDYRIACQQQQQHQQQ----LQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQ----QHQ 270
            |||.| ||.......::..||::    |.:.:::.:.::.......:.:|..:.....    .|:
 Frog    54 FKPFP-EPSGPGNVLKRGLHQKEFLSYLNITKKEGKNKKFPSGLGFRREHSVEGGENDYPVFYHK 117

  Fly   271 HQHQQQHQSLQLPTEGG--------------------------QAGGVAAERYG-------YGST 302
            .....:.....||..|.                          |:|...::..|       .||.
 Frog   118 DHRGTEFSKSSLPERGHLDKSRFGPSALKSSNVKTFMSIQSLYQSGNKLSKSNGSLNTLGCVGSP 182

  Fly   303 PSLAPLPTASAQ-----KFGSTTDLRHLAARRRNH-RLLQRCSNEDALTLDLLST---------G 352
            |...||...::|     :.|:..:...|:..|:|. ..|...|...::....:|.         |
 Frog   183 PCRGPLQPCNSQSNNQSESGNDEEDDSLSDSRQNSINSLNSYSPGFSVARGQISASLGQINHIGG 247

  Fly   353 SHDRPDGASSKSSGTVVGS----------------SDLTPSPSDSGIS------ELEAALKDRDS 395
            |.||   ||.....||.|.                |...|.|.:...|      :||..|.::..
 Frog   248 SLDR---ASRVMRETVAGEKSTFSCRSMATLSRLCSGEPPPPYEYSQSVEDVARQLEEKLHEKGM 309

  Fly   396 ELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQ 460
            |...||:....::....||.:||...|..|...|:..|..:.::...:..:.::.|.||.::::|
 Frog   310 EARQLRKNASDSDDPFTQVFEDKRRLWMEELDELKQMYMSKLQQISQQALRSQRALQLQLYKVQQ 374

  Fly   461 HKLRQSEQVNRLQQQLDLARDSSQGLQQ---QVDALRHQLEDSEWRVCERNGEIALLKTQLKEAH 522
            .|       .|||::|:..|..|:.|:|   |.|....:||||:|.:.::.|||:|||.||:::.
 Frog   375 EK-------KRLQEELNTLRGESEELRQKQSQSDNSGPKLEDSKWEISQKAGEISLLKQQLRDSQ 432

  Fly   523 LEINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQ 587
            .|||:|...:||||                     |...:.|...||::::..            
 Frog   433 AEINVKLGEVVSLK---------------------TQLREAKALVKEKEKESD------------ 464

  Fly   588 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKE 652
                                                                            |
 Frog   465 ----------------------------------------------------------------E 465

  Fly   653 LSDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAH 717
            ||                |||                                ||...|.|.|. 
 Frog   466 LS----------------TRL--------------------------------QVLEDAKSQAP- 481

  Fly   718 VATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEKR 782
            |..|..:.:...|:.|...|.|::.|...|                          .|..|.|::
 Frog   482 VDLPRDSSDTIDLERLRAELMLERRQNEAQ--------------------------MLTFETERK 520

  Fly   783 QWSAEKDKVLGYQKQLQAHYIQMYQKLRCLD----SAGAAVGQVEATSG 827
            .|..||:|||.|||::|:.|::||.:.:.|:    .....|||..::||
 Frog   521 VWKEEKEKVLRYQKEIQSSYLEMYHRNQALERQVLELRQGVGQSPSSSG 569

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 16/35 (46%)
n4bp3XP_002936896.2 flagell_FliJ 351..470 CDD:131526 45/239 (19%)
Fez1 411..554 CDD:284284 57/315 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.