DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts3

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_002936402.1 Gene:lzts3 XenbaseID:XB-GENE-961223 Length:654 Species:Xenopus tropicalis

Alignment Length:799 Identity:156/800 (20%)
Similarity:310/800 (39%) Gaps:202/800 (25%)


  Fly    47 LENNAPL---ALRSTPS----MGQSSLGSPLLQFGQAAPGQGHSQGFHTGTLKSRQEQRRLSQKF 104
            ||:.:.|   |.:|..|    :.:||...|....|....|..:.|.|...::.:| .|..|.|..
 Frog     4 LESRSVLSDTAYQSQESFHSFVSRSSESPPHCTMGSVGSGVANDQEFPMKSVGTR-TQNSLKQND 67

  Fly   105 GSHSNLDDEGVGIGVGMGMGMGLQMRSKFQNIRQMFELSRSCVGGGGGDGRGGAAEEEAMQSLPA 169
            .|.:...                   :::....::::|.::.    |....|...:.|.|::.|.
 Frog    68 SSRNGYS-------------------NRYSGEEKIYKLDKNT----GMYINGEQRKCEKMKTDPC 109

  Fly   170 ---------TLPQ--QHQQQQQRRTTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKPIPFEPDY 223
                     .:||  |:::....:..|::           |:.||::...:||.||||:      
 Frog   110 GNVSANNEKNMPQAAQYRESNPPKIVPVS-----------GKLEQSNEPLVRPSAFKPV------ 157

  Fly   224 RIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQLPTEGGQ 288
                ..:..|..|...........:.::.......:..........:..|.:....:...::.|:
 Frog   158 ----VPKNFHSMQNLCPPLNNGVSENRKSSNHGNSNSPAAMKNSLEKSSHNRSSNQVGGLSDSGR 218

  Fly   289 AGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNEDALTLDLLSTGS 353
            ....:...||.|.:..:.|:..:::          |:      :|:......::.:..:..:|..
 Frog   219 NSLTSLPTYGSGYSQHVGPMSASTS----------HI------NRIGTSYIEKNIVGYNGTTTSE 267

  Fly   354 HDRPDGASSKSSGTVVGSSDLTP--SP-SDSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQ 415
            ..|....|:.|...:...::..|  || ||..|.:||..|.:::.|:..::::::.:|..||||.
 Frog   268 SGRSSSKSASSFSRLNHLNETLPFHSPSSDDIIQDLEDRLWEKEQEVIQMKRSLDKSEAAIFQVF 332

  Fly   416 KDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLAR 480
            ::|:..||.|.:.||..|..:.::...|.::.:|.|.||.|:|:|.|.:..|.|.:|.|:.:...
 Frog   333 EEKQKIWEREMEDLRQNYANKLQQVSKKAQRAQQALQLQIFKLQQEKKKLQEDVAQLLQEREEME 397

  Fly   481 DSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSS 545
            ......:::......::|:::|.||::.|||:|||.|||:...:::.|.:.||.|:         
 Frog   398 KKCMAFKKEQAEFLPKIEETKWEVCQKAGEISLLKQQLKDCQADLSQKLNEIVGLR--------- 453

  Fly   546 SNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 610
                      |...:::...:.||||..........:....:..:.:.|::|.:.||.:::..|.
 Frog   454 ----------TQLKEAKAFLREKEEQIASIKDSYSSKSVSLEICENEMQRKQSEAQQMKEKLSQC 508

  Fly   611 QQQQQQLKQQ-----HQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGRY 670
            :|:...||:.     ..|...:|.:  .|:|.:  |..|:.||::::..|..|:           
 Frog   509 EQEISSLKEALASLGQNPYTIELNE--KLRDTL--ACESDEAKMKRQNEDSVIS----------- 558

  Fly   671 TRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLVQ 735
              ||:.::.|                                                :|::.|:
 Frog   559 --LKKDIERL------------------------------------------------QLELTVE 573

  Fly   736 RLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQA 800
            :.|.|     ||.:|                          .|.|:..|..||:||:.||||||.
 Frog   574 KQQRD-----QQVVD--------------------------FEEERHTWQEEKEKVIKYQKQLQL 607

  Fly   801 HYIQMYQKLRCLDSAGAAV 819
            :|::||||.:.|:...|.:
 Frog   608 NYVEMYQKNQQLEQRMAEI 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 11/32 (34%)
lzts3XP_002936402.1 Fez1 417..623 CDD:284284 68/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17899240
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.