DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts1

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001116277.1 Gene:lzts1 XenbaseID:XB-GENE-960311 Length:499 Species:Xenopus tropicalis

Alignment Length:565 Identity:97/566 (17%)
Similarity:204/566 (36%) Gaps:140/566 (25%)


  Fly   116 GIGVGMGMGMGLQMRS-KFQNIRQM---------FELSRSCVGGGGGDGRGGAAEE----EAMQS 166
            |.|.....|.|.|.|. |..:::::         |..|:......||..:.|.:|:    :..|.
 Frog    10 GHGFNHKQGRGSQHRGRKPPHLKKLSRCSDGILRFGFSQESGHAKGGGSKMGRSEDFFYIKVSQK 74

  Fly   167 LPATLPQQHQQQQQRRTTPIAGGSRHQQQQQMGEAEQTSG-----NF-----LRPIAFKPIPFEP 221
            .... |:|........|.|    .....|:..|...:|..     :|     |...|.:|.|.:|
 Frog    75 SHVG-PRQEYHGAVTNTEP----EPQSSQEYSGPPNKTCNPPSMIHFPNRLELEMNALRPSPLKP 134

  Fly   222 DYR----IACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQHQHQHQQQHQSLQL 282
            ..|    :.|....:...||.|..:..:.::.:.:                              
 Frog   135 GMRRNSAVTCYPAAESGPQLSLYYRSDRSREAESR------------------------------ 169

  Fly   283 PTEGGQAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAARRRN-----HRLLQRCSNED 342
              .|...||::.     ....|::.||| ...|.|:...|..|......     |.:.| .|..:
 Frog   170 --AGHCIGGMSE-----SGRNSMSSLPT-HPSKLGTACQLDALLMPTGRFGGSAHNITQ-SSRSN 225

  Fly   343 ALTLDLLSTGSHDRPDGASSKSSGTVVGSSDLTPSPSDSGISELEAALKDRDSELSYLRQAMEHN 407
            .|:|..:|..     ||.::....:|.....|...||...::.:|......:.....:.::.:.:
 Frog   226 MLSLRAMSLS-----DGGNANKILSVPPKPGLRSPPSCDDLARVEPVENKEEGHRGGITRSRQSS 285

  Fly   408 EKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRL 472
            ::                         ||:.:..|      |:...|:.:.|:.|:|..|:..::
 Frog   286 QR-------------------------GQRGQHVL------QIQVTQERESKESKMRSYEKEKKM 319

  Fly   473 QQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKH 537
                               ::...:::::|..|::.|||:.|:.||::...|.:::...|:|||.
 Frog   320 -------------------SMSPSMDETQWEACQKPGEISSLRQQLRDTQEESSLRASEILSLKA 365

  Fly   538 SSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQ----QQ 598
            ....:...:.:...::.:|.......::..:|.:|.|...||...:.:.:.::|..:|.    |:
 Frog   366 QLRETKGRAEAQEQRARETEERLRIMEEDREEREQDQSEAELDTLRTELEAERQNNEQMTDVFQR 430

  Fly   599 QQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALT 643
            :::...:::::..:.|:||:|.:....|:.|.:    :|.:.|||
 Frog   431 ERKIWLEEKEKVIRYQRQLQQSYLHMFQRCQAV----EQRLRALT 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 7/32 (22%)
lzts1NP_001116277.1 Fez1 328..467 CDD:284284 29/143 (20%)
GBP_C <345..465 CDD:303769 22/124 (18%)
coiled coil 442..453 CDD:293879 4/11 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.