DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts2b

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_017214089.1 Gene:lzts2b ZFINID:ZDB-GENE-030131-9587 Length:608 Species:Danio rerio

Alignment Length:849 Identity:163/850 (19%)
Similarity:300/850 (35%) Gaps:298/850 (35%)


  Fly    15 VPPPGTPPVLGGSGCSNLSLPSGKRGHKRS-VSLENNAPLALRSTPSMGQSSLGSPLLQFGQAAP 78
            :.|...|..||..|..:..:|:.....:|: :.:..|   ..:.||..|:.....|  |.|...|
Zfish    11 IDPRLHPAELGAMGAVSSMIPNHITYPERADIEVSTN---FRKGTPDSGRLLWDVP--QAGSRTP 70

  Fly    79 GQ------GHSQGFHTGTLKSRQEQRRLSQKFGSHSNL----DDEGVGIGVGMGMGMGLQMRSKF 133
            |.      |.::||.|.:.              ||.:|    :|..:.:|:              
Zfish    71 GNRRRAIVGRAKGFGTRSY--------------SHEDLIRDWNDNHMDVGM-------------- 107

  Fly   134 QNIRQMFELSRSCVGGGGGDGRGGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQM 198
                      .|.|.|                  |..|            .|::|......||.:
Zfish   108 ----------TSAVDG------------------PPKL------------VPVSGQLERNIQQAI 132

  Fly   199 GEAEQTSGNFLRPIAFKP-IPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQ 262
                      :||.|||| ||                        :.:...|....:|.......
Zfish   133 ----------IRPTAFKPVIP------------------------KSRNTAQFLSPRLGTGLSGS 163

  Fly   263 QQHQQQHQHQHQQ-QHQSLQLPTE-GGQAGGVAAERYGYGSTP--SLAPLPTASAQKFGSTTDLR 323
            |.:..:.....:. .|.:|:..:. .|....:.::.:....||  ||..||..:.|...|:    
Zfish   164 QGNLSRFSPDAEDVSHATLERRSSYSGARNALFSQSFTMTETPRGSLTNLPAYTQQHVESS---- 224

  Fly   324 HLAARRRNHRLLQRCSNEDALTLDLLSTGSHDRPDGASSKSSGTVVGSSDLT-------PSPS-- 379
                     :|...||:              |....:||||:|::.|...:.       |||.  
Zfish   225 ---------KLPGNCSS--------------DSGRSSSSKSTGSLGGRGHMLSDRGSAGPSPPPI 266

  Fly   380 ---DSGISELEAALKDRDSELSYLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQ 441
               ::.:.:||..|::|:.||..||:.::.||..|.||.::::...|.|.:..|.....:.::..
Zfish   267 EAYEAIVRDLEEKLRERELELQRLRENLDENEAAICQVYEERQKRTELEIEEFRQMCAAKMQKAS 331

  Fly   442 LKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCE 506
            .|.::.:|:|.:|.||::|.|.:..|::.::.::.....:.....:::...|..:||:::|.||:
Zfish   332 QKAQREQQMLQMQVFQMQQEKKKHQEEMTQILKERQRLEERCSSFEREHTQLGPRLEETKWEVCQ 396

  Fly   507 RNGEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQ 571
            ::|||:|||.|||:...::..:...:|:::                                 .|
Zfish   397 KSGEISLLKQQLKDLQADLAQRVGELVTVR---------------------------------GQ 428

  Fly   572 QQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKD 636
            .::...|||..|.|.|:.....:.:..:.:..|.:.|:::.:.:.|:::                
Zfish   429 LREVRSELQTSQNQLQEANTTSRTRILELEVCQNELQRRKSENELLREK---------------- 477

  Fly   637 QVIGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVA 701
              |..|..:.:::|..|:..|         .|:..||.::.:.|     ||              
Zfish   478 --ISHLEEDSSQMRDALNAAA---------SGKEQRLAEETEEL-----KT-------------- 512

  Fly   702 SPAAQVAPPAPSPAAHVATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKL 766
                                                       ::|..|.|..|       :|..
Zfish   513 -------------------------------------------SRQQADRLKAE-------LAYE 527

  Fly   767 RQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCLDSAGAAVG-------QVEA 824
            ||:..|.....|.|::.|..|||||:.||||||.:|:|||::.|.|:.:...:.       |.:.
Zfish   528 RQRFSDQAAAFESERKSWEEEKDKVIRYQKQLQQNYVQMYKRNRDLERSLRELSLELESREQDDD 592

  Fly   825 TSGN 828
            :|||
Zfish   593 SSGN 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 13/32 (41%)
lzts2bXP_017214089.1 DUF4200 288..372 CDD:290574 19/84 (23%)
Fez1 390..577 CDD:284284 62/316 (20%)
DUF3166 464..527 CDD:288256 18/159 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17899562
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T598133
orthoMCL 1 0.900 OOG5_136019
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.