DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32988 and CG32983

DIOPT Version :9

Sequence 1:NP_788008.1 Gene:CG32988 / 318274 FlyBaseID:FBgn0052988 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_788009.1 Gene:CG32983 / 50434 FlyBaseID:FBgn0052983 Length:250 Species:Drosophila melanogaster


Alignment Length:223 Identity:70/223 - (31%)
Similarity:116/223 - (52%) Gaps:10/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EGPEVLVINERELRAFIFRVYLSSVVLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILS 90
            |..||.::       |...||:.:|:||..|:...:.:::|.:.:.:.:||||:|||:.|..||:
  Fly    14 EADEVQLV-------FARTVYIEAVLLCSASAFPLMFIASLKISIVRILPVPPYVWLLFALAILA 71

  Fly    91 VLGCIAQTPALTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYGAKSPE 155
            ||.|:..:....|:.|.:|.|.:..|||..|||:::..:..|::...|...:|..|...|||..:
  Fly    72 VLICLPISRVRPLIVWTMVGGVVGLLTLSAAYYVNMYDIPDLVLYFTVMALVLGGLMFSGAKCRK 136

  Fly   156 VLLPNIICTCCIFLLLTVTMIVLLILFLIINDMRYLL-ALAIVFVILIAFMAPFQARFICGRLQQ 219
            ..|||.:.|..|..:..|.::.|.:|.::  ..||.. ....|...|:..:.|.:|:|:.||||.
  Fly   137 SFLPNGLVTGVIVTIFLVALLPLSVLSVV--STRYFFPTFCAVLSALVLIVIPLEAQFMHGRLQY 199

  Fly   220 VPYGETADCANGIYLHFIFLLSCMLVFA 247
            .|.|....|:..|||:...|..|:.||:
  Fly   200 SPLGLEPICSMLIYLNSFTLFFCICVFS 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.