DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32988 and ZC13.2

DIOPT Version :9

Sequence 1:NP_788008.1 Gene:CG32988 / 318274 FlyBaseID:FBgn0052988 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_508172.1 Gene:ZC13.2 / 180438 WormBaseID:WBGene00022503 Length:321 Species:Caenorhabditis elegans


Alignment Length:290 Identity:52/290 - (17%)
Similarity:97/290 - (33%) Gaps:108/290 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LRTGRPGGEPVPAEGPEVLVINERELRAFI-------FRVYLSSVVLCLLSSIS----------- 59
            |...:.||     :.|:...:|......||       ..:::.:|:|.:.:|||           
 Worm     9 LENPQNGG-----QDPQRRALNSLSPTFFIKPKTTGLISLFIQTVILIISASISLFFFYHVGGYE 68

  Fly    60 ---W----IILSALAVRVYKAIPVP---------------------PFVW----------LIL-- 84
               |    .||..:...:.| ||:|                     |:::          |:|  
 Worm    69 YTHWNENSTILEPINHNINK-IPLPMSEGANSLVSTVSRKLDFLEIPYLYNDSADVETVNLLLDS 132

  Fly    85 -----AFIILSVLGCIAQTPALTLLCWGLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLA 144
                 .|:..:..| |.|.|..|     :::|.:.|             .|:.:|.|.....|:.
 Worm   133 SGVPDIFMENASFG-IEQVPMTT-----VIIGDIEF-------------DWLEVIRISTIVYLVI 178

  Fly   145 LLHLYGAKSPEVLLPNIICTCCIFLLLTVTMIVLLILFLIIN------------DMRYLLALAIV 197
            :...:|  |....:..|.|......:...|:::|::||.|.:            :|.:......:
 Worm   179 ICFWFG--SGVFFIFTIRCEVLDTAIFNTTILILVVLFQIAHAGLVTSLIFFQREMSWRTLSITI 241

  Fly   198 FVILIAFMAPFQARFI-----CGRLQQVPY 222
            ..|:|.|...|.. |:     ||.::.:.|
 Worm   242 GTIVILFCCAFLG-FVCITLNCGWVKYIDY 270



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.890

Return to query results.
Submit another query.