DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32987 and CG32988

Sequence 1:NP_788007.1 Gene:CG32987 FlyBaseID:FBgn0052987 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_788008.1 Gene:CG32988 FlyBaseID:FBgn0052988 Length:255 Species:Drosophila melanogaster

Alignment Length:214 Identity:50/215 (23%)
Similarity:102/215 (47%) Gaps:9/215 (4%)


  Fly    23 FIRSIYNIGLILIGITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSPCK 87
            ||..:|...::|..::..:||:|....:.:.:.:|.|.:|..::.|:::..:.||.:....:...
  Fly    41 FIFRVYLSSVVLCLLSSISWIILSALAVRVYKAIPVPPFVWLILAFIILSVLGCIAQTPALTLLC 105

  Fly    88 WFMTGLV---VVCTTLFGCHFIHDLSPLIISFVMIGVALIIMLLNFSGAMCPQEFLPGGVCSTLL 149
            |   |||   :...||||.:::|.:...::...::....::.||:..||..|:..||..:|:..:
  Fly   106 W---GLVLGSLFFLTLFGAYYMHLVRVWVLLIAILVAGSLLALLHLYGAKSPEVLLPNIICTCCI 167

  Fly   150 MMALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLIIAIPIQAQFNHGRLNVVEVVPEEHLMVCT 214
            .:.|.:.:.::.|:.|....:..|.....:..:::....|.||:|..|||   :.||......|.
  Fly   168 FLLLTVTMIVLLILFLIINDMRYLLALAIVFVILIAFMAPFQARFICGRL---QQVPYGETADCA 229

  Fly   215 LTLYLHSMMFFFCVCYFIL 233
            ..:|||.:....|:..|.|
  Fly   230 NGIYLHFIFLLSCMLVFAL 248



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131301628
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.