DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and MED22

DIOPT Version :9

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_598395.1 Gene:MED22 / 6837 HGNCID:11477 Length:200 Species:Homo sapiens


Alignment Length:149 Identity:52/149 - (34%)
Similarity:87/149 - (58%) Gaps:15/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:|:..:|||::.|::.||.|::|........|::..|:.|.:.:||.|||.|.|||||:|:
Human    12 ETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKS--- 133
            |||.|:|::.|:.|:.::.|.:|::::.:.....|.|:.||.:..::..:|.|||.|||..|   
Human    77 KLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSL 141

  Fly   134 ------------GGPDLDS 140
                        |..|||:
Human   142 CEANDLPLCEAYGRLDLDT 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 36/101 (36%)
MED22NP_598395.1 Med22 20..124 CDD:283768 36/103 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.