DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and MED22

DIOPT Version :8

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_598395.1 Gene:MED22 / 6837 HGNCID:11477 Length:200 Species:Homo sapiens

Alignment Length:149 Identity:52/150 (35%)
Similarity:87/150 (58%) Gaps:15/150 (10%)


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:|:..:|||::.|::.||.|::|........|::..|:.|.:.:||.|||.|.|||||:|:
Human    12 ETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKS--- 133
            |||.|:|::.|:.|:.::.|.:|::::.:.....|.|:.||.:..::..:|.|||.|||..|   
Human    77 KLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSSSSL 141

  Fly   134 ------------GGPDLDS 140
                        |..|||:
Human   142 CEANDLPLCEAYGRLDLDT 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 36/102 (35%)
MED22NP_598395.1 Med22 20..124 CDD:283768 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181192308
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003769
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12434
Phylome 1 0.910 0.816 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.