DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and med22

DIOPT Version :8

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_005171888.1 Gene:med22 / 415234 ZFINID:ZDB-GENE-040625-156 Length:198 Species:Danio rerio

Alignment Length:129 Identity:49/130 (38%)
Similarity:81/130 (62%) Gaps:0/130 (0%)


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:::..:|||::.|:|.||.|::|........|::..|:.|.:.|||.|||.|.|||||:|:
Zfish    12 ETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKSGG 135
            |||.|:|::.|:.|:.::.|.:..:::.:.....|.|:.||.:..::..:|.|||.|||..|.|
Zfish    77 KLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEEYYSSSCG 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 37/102 (36%)
med22XP_005171888.1 Med22 20..124 CDD:283768 37/104 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181188926
eggNOG 1 0.900 E1_KOG3304
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003769
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12434
Phylome 1 0.910 0.816 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.