DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and med22

DIOPT Version :9

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:XP_005171888.1 Gene:med22 / 415234 ZFINID:ZDB-GENE-040625-156 Length:198 Species:Danio rerio


Alignment Length:129 Identity:49/129 - (37%)
Similarity:81/129 - (62%) Gaps:0/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:::..:|||::.|:|.||.|::|........|::..|:.|.:.|||.|||.|.|||||:|:
Zfish    12 ETLLQNYNKRLKDDIRSILDNFTEIIKTAKVEDETQVSRATQAEQDHFEMHVRAANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKSGG 135
            |||.|:|::.|:.|:.::.|.:..:::.:.....|.|:.||.:..::..:|.|||.|||..|.|
Zfish    77 KLVSDLKQFLILNDFPSVNEAISLRNQQLRTLQEECDKKLISLRDEIAIDLYELEEEYYSSSCG 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 37/101 (37%)
med22XP_005171888.1 Med22 20..124 CDD:283768 37/103 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578650
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.