DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and MED22

DIOPT Version :8

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_569870.1 Gene:MED22 / 31038 FlyBaseID:FBgn0040339 Length:143 Species:Drosophila melanogaster

Alignment Length:124 Identity:58/125 (46%)
Similarity:84/125 (67%) Gaps:0/125 (0%)


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            ||||||:..:|||:|.|||.||||:|||....:..||:..|:.|.:|.||||||.|.|||||:|:
  Fly    15 EALLKSYNARLKDDVRSMLENFEEILKLARRESHSQISKTTQCEQDALEMQVRAANMVRAGESLM 79

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYY 130
            |||.|:|:|.|:.|:.::.|.:...|:......:|.|:.|:|:..::..:|.:||.|||
  Fly    80 KLVADLKQYLILNDFHSVNEAITNNSQLFRNTQSECDKKLMKLRDEMAMDLYDLEEEYY 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 46/102 (45%)
MED22NP_569870.1 Med22 24..128 CDD:283768 46/104 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181177541
eggNOG 1 0.900 E1_KOG3304
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I2387
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003769
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12434
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.