DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and mdt-22

DIOPT Version :9

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_496216.1 Gene:mdt-22 / 174595 WormBaseID:WBGene00007022 Length:157 Species:Caenorhabditis elegans


Alignment Length:134 Identity:43/134 - (32%)
Similarity:67/134 - (50%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLKSFKTQLKDNVLSMLLNFEELLKL--VSP---RTPGQITNDTEQELNAFEMQVRAGNFVRAGE 68
            ::..||.:|:||:.|:..||..:::.  |:|   ....|....||......||.|||...|||.:
 Worm    23 IIDEFKRRLRDNIKSLNDNFFHIIQAAKVNPDDNAYKNQTGKMTEFYTTKNEMAVRAQLMVRASD 87

  Fly    69 ALIKLVHDVKEYQIIYDY----SNIE------EEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELS 123
            .|:||..|:||:.|::|:    .||:      ||..||....|..:   |..:..::.|||.|::
 Worm    88 ELLKLTADLKEFLILHDFHFLTHNIKQAEAQCEETLRQQSHQHNCL---DSEVSNILFDLEREIA 149

  Fly   124 ELEY 127
            |..|
 Worm   150 ENFY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 35/116 (30%)
mdt-22NP_496216.1 Med22 29..139 CDD:283768 35/112 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158553
Domainoid 1 1.000 62 1.000 Domainoid score I6846
eggNOG 1 0.900 - - E1_KOG3304
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I3891
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 1 1.000 - - otm14177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.