DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and med22

DIOPT Version :9

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001120562.1 Gene:med22 / 100145716 XenbaseID:XB-GENE-959336 Length:199 Species:Xenopus tropicalis


Alignment Length:127 Identity:48/127 - (37%)
Similarity:83/127 - (65%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:|:..:|||::.|::.||.|::|........|::..|:.|.:.:||.||:.|.|||||:|:
 Frog    12 ETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIDEEHQVSRSTQGEQDNYEMHVRSANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKS 133
            |||.|:|::.|:.|:.::.|.::::::.:.|...|.|:.||.:..|:..:|.|||.|||..|
 Frog    77 KLVSDLKQFLILNDFPSVNESINQRNQQLRALQDECDKKLIALRDDIAIDLYELEEEYYSSS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 35/101 (35%)
med22NP_001120562.1 Med22 20..124 CDD:368777 36/103 (35%)
CF222 <142..>193 CDD:373996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004687
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12434
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.