DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and med22

DIOPT Version :10

Sequence 1:NP_788052.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001120562.1 Gene:med22 / 100145716 XenbaseID:XB-GENE-959336 Length:199 Species:Xenopus tropicalis


Alignment Length:127 Identity:48/127 - (37%)
Similarity:83/127 - (65%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:|:..:|||::.|::.||.|::|........|::..|:.|.:.:||.||:.|.|||||:|:
 Frog    12 ETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIDEEHQVSRSTQGEQDNYEMHVRSANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKS 133
            |||.|:|::.|:.|:.::.|.::::::.:.|...|.|:.||.:..|:..:|.|||.|||..|
 Frog    77 KLVSDLKQFLILNDFPSVNESINQRNQQLRALQDECDKKLIALRDDIAIDLYELEEEYYSSS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32971NP_788052.1 Med22 15..116 CDD:461845 35/100 (35%)
med22NP_001120562.1 Med22 20..121 CDD:461845 35/100 (35%)
CF222 <142..>186 CDD:464786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.