DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32971 and med22

DIOPT Version :8

Sequence 1:NP_001137823.1 Gene:CG32971 / 318271 FlyBaseID:FBgn0052971 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_001120562.1 Gene:med22 / 100145716 XenbaseID:XB-GENE-959336 Length:199 Species:Xenopus tropicalis

Alignment Length:127 Identity:48/128 (38%)
Similarity:83/128 (65%) Gaps:0/128 (0%)


  Fly     7 EALLKSFKTQLKDNVLSMLLNFEELLKLVSPRTPGQITNDTEQELNAFEMQVRAGNFVRAGEALI 71
            |.||:|:..:|||::.|::.||.|::|........|::..|:.|.:.:||.||:.|.|||||:|:
 Frog    12 ETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIDEEHQVSRSTQGEQDNYEMHVRSANIVRAGESLM 76

  Fly    72 KLVHDVKEYQIIYDYSNIEEEMDRQSEAMHAKVTEYDQTLIKMVKDLEEELSELEYEYYEKS 133
            |||.|:|::.|:.|:.::.|.::::::.:.|...|.|:.||.:..|:..:|.|||.|||..|
 Frog    77 KLVSDLKQFLILNDFPSVNESINQRNQQLRALQDECDKKLIALRDDIAIDLYELEEEYYSSS 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32971NP_001137823.1 Med22 15..117 CDD:283768 35/102 (34%)
med22NP_001120562.1 Med22 20..124 CDD:283768 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C181190718
eggNOG 1 0.900 E1_KOG3304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003769
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.773 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.