DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and CG34290

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:110/292 - (37%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WSVFLFLLAALL----------RPVRGDLDAQSRIIGGYDVDIEDAPYQA---EVIIDGTA---- 50
            ||.|.:||.:|.          .|:.|     .||:..........|:..   :||...|.    
  Fly    10 WSWFYWLLHSLFIISVLESCHAVPIVG-----GRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVS 69

  Fly    51 ---ICSGAIITSDTIITAASCVQSYGSIEVRVGTSSRDYDGTGFL----LEVCEIINHPQYNCWR 108
               .|.|::|:...|::||.||.......:.......:.:..|.|    ||..|.|.....|   
  Fly    70 YQHFCGGSLISDRWILSAAHCVWRKNIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSN--- 131

  Fly   109 FDNNLALLKL--------CDPLKTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGS 165
            |.|::|||.:        .:.|:.:: :.|..:   :||....|.:.|:|:|...|....|.|  
  Fly   132 FRNDIALLYMKRRYWSDFGNGLQYAQ-LPPHGM---KPDQNESCRIIGYGATHHAGPCQKRLF-- 190

  Fly   166 LPDYLQMAWVSVYNREQCAADRGVWFGLW--DNGISYLTLCT-HNGAGGCSYDTGAPLVI----D 223
                  .|.|.|.:.::|   |.:...:|  .||.:  |:|. .|....|..|:|.||:.    .
  Fly   191 ------EAEVRVIDNQKC---RDIIGHIWAPQNGAN--TVCALGNNQDSCQGDSGGPLICTYGGK 244

  Fly   224 GQLVGILSEG---GCTTKPDVYANVPWFTGWI 252
            ..:.|::|.|   |....|.:|.....:..|:
  Fly   245 DYIYGLVSHGLTCGIPGMPSIYTVTRPYYDWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 59/257 (23%)
DUF5585 284..>552 CDD:465521
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 61/268 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.