DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and CG11192

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:276 Identity:95/276 - (34%)
Similarity:130/276 - (47%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLFLLAALL-----RPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITA 65
            ||:.|.||:     .|..||    .||:||....|::.|||..|.:.|..||.||||..||::||
  Fly     6 FLWWLMALVAYAGATPTPGD----GRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTA 66

  Fly    66 ASCVQ---SYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSEA 127
            |.|.:   |.....||||:|  :::..|.:|.:..:|.|..||....||:||||.|...|..:|.
  Fly    67 AHCFEDPWSSADYTVRVGSS--EHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129

  Fly   128 IQPISIA--EDEPDDGSWCTVSGWG----STSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCAAD 186
            :||:.:|  .|.|...:...|||||    .::..|.     .|..|. |:...|.:....||   
  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGE-----VGVSPQ-LRFVDVDLVESNQC--- 185

  Fly   187 RGVWFGLWDNGISYLTLC-THNGAGGCSYDTGAPLV----IDG--QLVGILSEG-GCTTK--PDV 241
            |..:..:..  |:...:| ...|...|..|:|.|||    .:|  :|.||:|.| ||...  |.|
  Fly   186 RRAYSQVLP--ITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGV 248

  Fly   242 YANVPWFTGWIAENTE 257
            |.||..|..||.|..:
  Fly   249 YTNVAAFRSWIDEQLD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 84/244 (34%)
DUF5585 284..>552 CDD:465521
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 84/244 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.