DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32834 and sphe

DIOPT Version :10

Sequence 1:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:260 Identity:67/260 - (25%)
Similarity:109/260 - (41%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITAASCVQSYGS------IEV 77
            |...||.||:||.|.|.....:.|.:.:|...:|.|:|::...|:|.|.||...|.      :..
  Fly    18 GMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLAC 82

  Fly    78 RVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPLKTSE---AIQPISIAEDEPD 139
            ||| |:..|.| |.::.|..:..||.|  :..:||||::.|...|..::   ||..::..|..|.
  Fly    83 RVG-STNQYAG-GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITAIPLVASGEALPA 143

  Fly   140 DGSWCTVSGWGSTS-WWGSWWDR-----------CFGSLPDYLQMAWVSVYNREQCAADRGVWFG 192
            :||...|:|||.|| ...|:..|           |..:..|:.:.::...:..::          
  Fly   144 EGSEVIVAGWGRTSDGTNSYKIRQISLKVAPEATCLDAYSDHDEQSFCLAHELKE---------- 198

  Fly   193 LWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILS--EGGCTTK-PDVYANVPWFTGWIAE 254
                             |.|..|.|...:....|:|:.:  .|.|.:: |||:..:..:..||.|
  Fly   199 -----------------GTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQE 246

  Fly   255  254
              Fly   247  246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 61/249 (24%)
DUF5585 284..>552 CDD:465521
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 57/236 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.