DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and MPC2

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_012032.1 Gene:MPC2 / 856567 SGDID:S000001205 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:47/114 - (41%)
Similarity:63/114 - (55%) Gaps:2/114 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVIT 90
            |.:..|||..||:||.||||..||.||.||.|| :.||...||..|..||..|.|||:|:|.||.
Yeast     9 AFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSD-MKRPVEKISGAQNLSLLSTALIWTRWSFVIK 72

  Fly    91 PKNYNLLAVNIAVFLIQGYLMVKHLRWRSENSRNAVFNHSHYPIKSGDD 139
            |:|..|.:||..:.|..||.:.:...:|..|. :::.....|.:...|:
Yeast    73 PRNILLASVNSFLCLTAGYQLGRIANYRIRNG-DSISQLCSYILSGADE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/96 (47%)
MPC2NP_012032.1 MPC 9..118 CDD:397629 46/110 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343253
Domainoid 1 1.000 99 1.000 Domainoid score I1572
eggNOG 1 0.900 - - E1_KOG1589
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1460
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57740
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - mtm9180
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - O PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.