DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and MPC2

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_012032.1 Gene:MPC2 SGDID:S000001205 Length:129 Species:Saccharomyces cerevisiae

Alignment Length:114 Identity:47/115 (41%)
Similarity:63/115 (55%) Gaps:2/115 (2%)


  Fly    26 AVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVIT 90
            |.:..|||..||:||.||||..||.||.||.|| :.||...||..|..||..|.|||:|:|.||.
Yeast     9 AFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSD-MKRPVEKISGAQNLSLLSTALIWTRWSFVIK 72

  Fly    91 PKNYNLLAVNIAVFLIQGYLMVKHLRWRSENSRNAVFNHSHYPIKSGDD 139
            |:|..|.:||..:.|..||.:.:...:|..|. :::.....|.:...|:
Yeast    73 PRNILLASVNSFLCLTAGYQLGRIANYRIRNG-DSISQLCSYILSGADE 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/97 (46%)
MPC2NP_012032.1 MPC 9..118 CDD:281629 46/111 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238697701
eggNOG 1 0.900 E1_KOG1589
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1439
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 1 1.000 T133842
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.750

Return to query results.
Submit another query.