DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and AT4G14695

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001319940.1 Gene:AT4G14695 AraportID:AT4G14695 Length:109 Species:Arabidopsis thaliana

Alignment Length:91 Identity:40/92 (43%)
Similarity:61/92 (66%) Gaps:1/92 (1%)


  Fly    27 VQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITP 91
            :|.||..||||:|:.||||.|||.:.:|.::| ..:||.|||..|..::..||:||.|.|.:|||
plant     6 LQALWNHPAGPKTIHFWAPTFKWGISIANIAD-FQKPPENISYLQQIAVTCTGMIWCRCSTIITP 69

  Fly    92 KNYNLLAVNIAVFLIQGYLMVKHLRW 117
            ||:||.:||:|:.....|.:.:.:::
plant    70 KNWNLFSVNVAMAATGIYQLTRKIKY 95

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 40/92 (43%)
AT4G14695NP_001319940.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoInspector 1 1.000 T32347
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.