DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and AT4G05590

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001031587.1 Gene:AT4G05590 AraportID:AT4G05590 Length:146 Species:Arabidopsis thaliana

Alignment Length:128 Identity:41/129 (32%)
Similarity:62/129 (48%) Gaps:39/129 (30%)


  Fly    27 VQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQ-------------------- 71
            :|.||..||||:|:.||||.|||.:.:|.::| ..:||..:|..|                    
plant     6 LQALWNHPAGPKTIHFWAPTFKWGISIANIAD-FQKPPETLSYPQQIGIILTIGLSYLYSAHIAV 69

  Fly    72 ---CGSLAV---------------TGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLR 116
               |.:..|               |||:|||||.||||||:||.:|::.:.:...|.:.:.::
plant    70 MYRCVNFNVYMMPRMAVIVSVITGTGLVWSRYSTVITPKNWNLFSVSLGMAVTGIYQLTRKIK 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 41/129 (32%)
AT4G05590NP_001031587.1 MPC 5..135 CDD:281629 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoInspector 1 1.000 T32347
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
65.920

Return to query results.
Submit another query.