DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and Mpc2

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_081706.1 Gene:Mpc2 / 70456 MGIID:1917706 Length:127 Species:Mus musculus


Alignment Length:100 Identity:49/100 - (49%)
Similarity:64/100 - (64%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANIS 68
            |...|...|:..:..::..:|..::||:..||||||||||||..||.||.|||:| ::||...:|
Mouse     5 GARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLAD-MARPAEKLS 68

  Fly    69 LNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAV 103
            ..|...|..||.||||||:||.|||::|.|||..|
Mouse    69 TAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 44/77 (57%)
Mpc2NP_081706.1 MPC 33..122 CDD:427425 42/71 (59%)

Return to query results.
Submit another query.