DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and Mpc2

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_081706.1 Gene:Mpc2 MGIID:1917706 Length:127 Species:Mus musculus

Alignment Length:100 Identity:49/100 (49%)
Similarity:64/100 (64%) Gaps:1/100 (1%)


  Fly     4 GTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANIS 68
            |...|...|:..:..::..:|..::||:..||||||||||||..||.||.|||:| ::||...:|
Mouse     5 GARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLAD-MARPAEKLS 68

  Fly    69 LNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAV 103
            ..|...|..||.||||||:||.|||::|.|||..|
Mouse    69 TAQSTVLMATGFIWSRYSLVIIPKNWSLFAVNFFV 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/78 (58%)
Mpc2NP_081706.1 MPC 33..122 CDD:308961 43/72 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238675760
eggNOG 1 0.900 E1_KOG1589
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 1 1.000 T616148
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.700

Return to query results.
Submit another query.