DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and mpc2

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001016695.1 Gene:mpc2 XenbaseID:XB-GENE-5802002 Length:132 Species:Xenopus tropicalis

Alignment Length:120 Identity:53/121 (44%)
Similarity:74/121 (61%) Gaps:2/121 (2%)


  Fly     1 MSKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPA 65
            |:...| |...|:..:..|:..:|..::||:..||||:|||||||..||.||:|||:| ::||..
 Frog     1 MAAAVG-LRATYHRALDRIEMMLPSKLRPLYNHPAGPKTVFFWAPIMKWGLVIAGLAD-MTRPAE 63

  Fly    66 NISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSE 120
            .:|..|...|..|||||||||:||.|||::|.|||..|....|..:.:..|:..:
 Frog    64 KLSTGQSAVLTATGLIWSRYSLVIIPKNWSLFAVNFFVGCAGGSQLFRIWRYNQD 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 47/96 (49%)
mpc2NP_001016695.1 MPC 25..131 CDD:281629 47/96 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238674702
eggNOG 1 0.900 E1_KOG1589
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.710

Return to query results.
Submit another query.