powered by:
                   
 
    
    
             
          
            Protein Alignment CG32832 and mpc2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001285999.1 | Gene: | CG32832 / 318237 | FlyBaseID: | FBgn0052832 | Length: | 140 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001016695.1 | Gene: | mpc2 / 549449 | XenbaseID: | XB-GENE-5802002 | Length: | 132 | Species: | Xenopus tropicalis | 
        
        
        
          
            | Alignment Length: | 120 | Identity: | 53/120 - (44%) | 
          
            | Similarity: | 74/120 -  (61%) | Gaps: | 2/120 - (1%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MSKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPA 65|:...| |...|:..:..|:..:|..::||:..||||:|||||||..||.||:|||:| ::||..
 Frog     1 MAAAVG-LRATYHRALDRIEMMLPSKLRPLYNHPAGPKTVFFWAPIMKWGLVIAGLAD-MTRPAE 63
 
 
  Fly    66 NISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSE 120.:|..|...|..|||||||||:||.|||::|.|||..|....|..:.:..|:..:
 Frog    64 KLSTGQSAVLTATGLIWSRYSLVIIPKNWSLFAVNFFVGCAGGSQLFRIWRYNQD 118
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | CG32832 | NP_001285999.1 | MPC | 26..123 | CDD:281629 | 47/95 (49%) | 
          
            | mpc2 | NP_001016695.1 | MPC | 25..131 | CDD:367595 | 47/95 (49%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1422466at2759 | 
          
            | OrthoFinder | 1 | 1.000 | - | - |  | FOG0002137 | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 0 | 0.000 | Not matched by this tool. | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X1420 | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 3.010 |  | 
        
      
           
             Return to query results.
             Submit another query.