DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and zgc:103678

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001004662.1 Gene:zgc:103678 ZFINID:ZDB-GENE-040912-107 Length:109 Species:Danio rerio

Alignment Length:98 Identity:46/99 (46%)
Similarity:65/99 (66%) Gaps:1/99 (1%)


  Fly    23 VPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSV 87
            :|..::|::..||||:|||||||.|||.||.||.|| ::|||..:|::|...:..||||||||.:
Zfish     2 LPPKLRPVYNHPAGPKTVFFWAPVFKWGLVAAGFSD-MTRPPEKLSVSQSCVITATGLIWSRYCL 65

  Fly    88 VITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSE 120
            ||.|||:.|.|||..:.:.....:.:..|:..|
Zfish    66 VIIPKNWALFAVNFFLGMCGSIQLFRIWRYNQE 98

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/96 (47%)
zgc:103678NP_001004662.1 MPC 11..108 CDD:281629 44/90 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238671304
eggNOG 1 0.900 E1_KOG1589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.