DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and Mpc1

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster


Alignment Length:85 Identity:25/85 - (29%)
Similarity:40/85 - (47%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLL---AVNIAV 103
            ||.|...|.:.:|.|:|| .:.|..||.....:|.:...|:.|::..:.|:|:.|.   |.|...
  Fly    24 FWGPVANWGIPVAALADT-QKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATA 87

  Fly   104 FLIQGYLMVKHLRWRSENSR 123
            ..||| |...|..:.|:..:
  Fly    88 QSIQG-LRFLHYNYGSKEQQ 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 25/83 (30%)
Mpc1NP_650762.1 MPC 21..107 CDD:427425 25/85 (29%)

Return to query results.
Submit another query.