DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and Mpc1

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001262720.1 Gene:Mpc1 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster

Alignment Length:85 Identity:25/86 (29%)
Similarity:40/86 (47%) Gaps:5/86 (6%)


  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLL---AVNIAV 103
            ||.|...|.:.:|.|:|| .:.|..||.....:|.:...|:.|::..:.|:|:.|.   |.|...
  Fly    24 FWGPVANWGIPVAALADT-QKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATA 87

  Fly   104 FLIQGYLMVKHLRWRSENSR 123
            ..||| |...|..:.|:..:
  Fly    88 QSIQG-LRFLHYNYGSKEQQ 106

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 25/84 (30%)
Mpc1NP_001262720.1 MPC 21..107 CDD:281629 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113558035
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR14154
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.