DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and CG9399

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001163571.1 Gene:CG9399 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster

Alignment Length:134 Identity:69/135 (51%)
Similarity:87/135 (64%) Gaps:8/135 (6%)


  Fly     2 SKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            |.|.|..|||||..|...|||||..::|||..||||:|:|||||.|||.||.||||| |:||...
  Fly    22 SAGKGIHSKLYNGMIGAADKFVPAKLRPLWMHPAGPKTIFFWAPVFKWGLVAAGLSD-LARPADT 85

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRW-------RSENSRN 124
            ||::.|.:||.||:||||||:||.||||:|.|||:.|.:.|...:.:...:       :.|..:.
  Fly    86 ISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQVVQLARAYHYHQSQEKLKQEQQQP 150

  Fly   125 AVFN 128
            ||.|
  Fly   151 AVQN 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 52/104 (50%)
CG9399NP_001163571.1 MPC 46..139 CDD:281629 51/94 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238669542
eggNOG 1 0.900 E1_KOG1589
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 P PTHR14154
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.