DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and CG9396

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_649912.1 Gene:CG9396 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster

Alignment Length:122 Identity:65/123 (53%)
Similarity:84/123 (68%) Gaps:1/123 (1%)


  Fly     2 SKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            |.|.|..|:.||..|...||:||..::|||..||||:|:|||||..|||||:||||| |:||...
  Fly    16 SAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSD-LTRPADK 79

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSENSR 123
            ||.|.|.:|..|.|||:|||:||.||||:|.|||:.|.|.|.:.:.::..::.|.||
  Fly    80 ISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSR 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 53/97 (55%)
CG9396NP_649912.1 MPC 40..136 CDD:281629 53/97 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238669565
eggNOG 1 0.900 E1_KOG1589
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 P PTHR14154
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.