DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and CG9396

DIOPT Version :9

Sequence 1:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_649912.1 Gene:CG9396 / 41156 FlyBaseID:FBgn0037714 Length:151 Species:Drosophila melanogaster


Alignment Length:122 Identity:65/122 - (53%)
Similarity:84/122 - (68%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKGTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            |.|.|..|:.||..|...||:||..::|||..||||:|:|||||..|||||:||||| |:||...
  Fly    16 SAGKGLHSRAYNGLIKACDKYVPPKMRPLWMHPAGPKTIFFWAPIVKWSLVIAGLSD-LTRPADK 79

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFLIQGYLMVKHLRWRSENSR 123
            ||.|.|.:|..|.|||:|||:||.||||:|.|||:.|.|.|.:.:.::..::.|.||
  Fly    80 ISPNGCLALGATNLIWTRYSLVIIPKNYSLFAVNLFVSLTQLFQLGRYYNYQWEQSR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 52/96 (54%)
CG9396NP_649912.1 MPC 40..136 CDD:281629 52/96 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446530
Domainoid 1 1.000 106 1.000 Domainoid score I2184
eggNOG 1 0.900 - - E1_KOG1589
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2090
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422466at2759
OrthoFinder 1 1.000 - - FOG0002137
OrthoInspector 1 1.000 - - otm42623
orthoMCL 1 0.900 - - OOG6_101975
Panther 1 1.100 - - P PTHR14154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1420
1110.800

Return to query results.
Submit another query.