DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and MPC2

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001137146.1 Gene:MPC2 HGNCID:24515 Length:127 Species:Homo sapiens

Alignment Length:100 Identity:49/100 (49%)
Similarity:64/100 (64%) Gaps:1/100 (1%)


  Fly     4 GTGPLSKLYNITISTIDKFVPGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANIS 68
            |...|...|:..:..::..:|..::||:..||||||||||||..||.||.|||:| ::||...:|
Human     5 GARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLAD-MARPAEKLS 68

  Fly    69 LNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAV 103
            ..|...|..||.||||||:||.|||::|.|||..|
Human    69 TAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFV 103

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 45/78 (58%)
MPC2NP_001137146.1 MPC 27..125 CDD:308961 45/78 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238671276
eggNOG 1 0.900 E1_KOG1589
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.