DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32832 and mpc2

DIOPT Version :10

Sequence 1:NP_724026.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_592846.1 Gene:mpc2 / 2541475 PomBaseID:SPAC24B11.09 Length:118 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:38/93 - (40%)
Similarity:59/93 - (63%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYN 95
            |..||||:||.|||||.||:|||:|:.| .:|.|..:|:.|..:|..||.||:|:|:::.||||.
pombe    10 WNHPAGPKTVHFWAPAMKWTLVLSGIGD-YARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYF 73

  Fly    96 LLAVNIAVFLIQGYLMVKHLRWRSENSR 123
            ...||..:.::....:.:.|.::.:..|
pombe    74 NATVNFFLAIVGAVQVSRILVYQRQQKR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32832NP_724026.1 MPC 26..123 CDD:427425 37/91 (41%)
mpc2NP_592846.1 MPC 5..105 CDD:427425 38/93 (41%)

Return to query results.
Submit another query.