DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and SPAC24B11.09

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_592846.1 Gene:SPAC24B11.09 PomBaseID:SPAC24B11.09 Length:118 Species:Schizosaccharomyces pombe

Alignment Length:93 Identity:38/94 (40%)
Similarity:59/94 (63%) Gaps:1/94 (1%)


  Fly    31 WQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYN 95
            |..||||:||.|||||.||:|||:|:.| .:|.|..:|:.|..:|..||.||:|:|:::.||||.
pombe    10 WNHPAGPKTVHFWAPAMKWTLVLSGIGD-YARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYF 73

  Fly    96 LLAVNIAVFLIQGYLMVKHLRWRSENSR 123
            ...||..:.::....:.:.|.::.:..|
pombe    74 NATVNFFLAIVGAVQVSRILVYQRQQKR 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 37/92 (40%)
SPAC24B11.09NP_592846.1 MPC 5..109 CDD:281629 38/94 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1580
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 1 1.000 T631587
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.920

Return to query results.
Submit another query.