DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32832 and mpc-2

Sequence 1:NP_001285999.1 Gene:CG32832 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_491234.1 Gene:mpc-2 WormBaseID:WBGene00018765 Length:133 Species:Caenorhabditis elegans

Alignment Length:132 Identity:54/133 (41%)
Similarity:72/133 (54%) Gaps:7/133 (5%)


  Fly     6 GPLSKLYNITISTIDKFV----PGAVQPLWQSPAGPRTVFFWAPAFKWSLVLAGLSDTLSRPPAN 66
            ||...||.......||||    |...:|.|...|||:|||||||..||:|:.|||:| |:||...
 Worm     2 GPHRLLYQALCKAGDKFVYPVLPAFAKPAWNHAAGPKTVFFWAPTIKWTLIGAGLAD-LARPADK 65

  Fly    67 ISLNQCGSLAVTGLIWSRYSVVITPKNYNLLAVNIAVFL--IQGYLMVKHLRWRSENSRNAVFNH 129
            :||.|..:|..||.||:||.:||||.||.|.:||..|..  :.....:.|.|:::.:........
 Worm    66 LSLYQNSALFATGAIWTRYCLVITPINYYLSSVNFFVMCTGLAQLCRIAHYRYQNPDWETKEIME 130

  Fly   130 SH 131
            :|
 Worm   131 TH 132

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32832NP_001285999.1 MPC 26..123 CDD:281629 44/99 (44%)
mpc-2NP_491234.1 MPC 31..130 CDD:281629 43/100 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238669595
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1422466at2759
OrthoFinder 1 1.000 FOG0002146
OrthoInspector 1 1.000 T374914
orthoMCL 1 0.900 OOG5_127980
Panther 1 1.100 O PTHR14154
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.