DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32819 and TEKT1

DIOPT Version :8

Sequence 1:NP_728444.1 Gene:CG32819 / 318227 FlyBaseID:FBgn0052819 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_444515.1 Gene:TEKT1 / 83659 HGNCID:15534 Length:418 Species:Homo sapiens

Alignment Length:390 Identity:130/391 (33%)
Similarity:220/391 (56%) Gaps:0/391 (0%)


  Fly   206 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWR 270
            ::..:||:..|..:|..::..|:.|||:..::.||:.|.::.....|.|..::|.:|:.::.||:
Human    10 KFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWK 74

  Fly   271 NELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVE 335
            .||:.:||:|:....|:...:.:..|||..|:.||||.:.||.:||.|.|.:.|||.||..|:.|
Human    75 KELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKE 139

  Fly   336 INNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGI 400
            ...::.....|....|:.|:|....|.|::.||.|:..|..:|.||.:|..|||:|..|.|....
Human   140 AEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENA 204

  Fly   401 EKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQ 465
            .:.:|:..:.|.|...||.:|.::..:|.....|::....:::..|..:.......:.||....:
Human   205 VRIEPNSVSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLK 269

  Fly   466 EMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQ 530
            :..:|::::..||.||.:|:...||::..|:|||.|:.||.|||.||||.|:||..||||:|.||
Human   270 DTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQ 334

  Fly   531 DRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPV 595
            .||::|||:|...|..|...|.:|:|..:||.:.:..|:.:::.|.|.::||...||.:|:|.|:
Human   335 YRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPL 399

  Fly   596  595
            Human   400  399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32819NP_728444.1 Tektin 212..591 CDD:281184 127/379 (34%)
TEKT1NP_444515.1 Tektin 16..395 CDD:281184 127/379 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2685
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264325at33208
OrthoFinder 1 1.000 FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.