DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32819 and Tekt5

DIOPT Version :8

Sequence 1:NP_728444.1 Gene:CG32819 / 318227 FlyBaseID:FBgn0052819 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001277930.1 Gene:Tekt5 / 70426 MGIID:1917676 Length:557 Species:Mus musculus

Alignment Length:485 Identity:175/486 (36%)
Similarity:279/486 (57%) Gaps:32/486 (7%)


  Fly   113 QAGAPPCMEPVMGPSIPPRVGAAYETP---TKHPWRPAMAYELIQVKHMPEQPVTNQLTKQCFLP 174
            ||..|...|||:.....|     :..|   ..:.|||::.:::...:.:||         :|   
Mouse    22 QALPPAGQEPVVQECYQP-----FHLPGYRYLNAWRPSVFHKIATSQTIPE---------EC--- 69

  Fly   175 KGMKTDGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVR 239
            .|::....|.|:|            |:||:.|||..:|..:|..:...:..:|..:.|:..|::|
Mouse    70 SGIRRPPTILPSL------------RSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLR 122

  Fly   240 LMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIP 304
            :|::.|:.....|....|.||:|::||.||::||..||::|:.|.|.::.|:|:...|..::..|
Mouse   123 IMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCP 187

  Fly   305 LHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLED 369
            |.:|.|||::||.|.|.:.|||.|||.|:.|::.|:..:|::..|.::|..|..|.|.|||.||.
Mouse   188 LQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLER 252

  Fly   370 DVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQL 434
            |:..|.|:..||..|..|.:.|..|:::.|:||||.:||..|:||:.|::::|.:|..||...:|
Mouse   253 DIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRL 317

  Fly   435 RSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAI 499
            |.:|:.:..:::..:|..::|||.||:.|..|..:.||::|..|.|:.||:|..|..:.||::||
Mouse   318 REEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAI 382

  Fly   500 QDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKT 564
            ..|..|||:|||.|..|:.|..||||:|..|.|||.||..|...::||..:|.|.:.|.|.|:.|
Mouse   383 VAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMT 447

  Fly   565 RCTLEVDLRNKVNALFIDREKCMSLRRSFP 594
            :..||.:|..|.|.|.||::||||:|:|||
Mouse   448 KSRLEHELAIKANTLCIDKDKCMSMRKSFP 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32819NP_728444.1 Tektin 212..591 CDD:281184 148/379 (39%)
Tekt5NP_001277930.1 Tektin 95..474 CDD:281184 148/379 (39%)
6 X 6 AA approximate tandem repeats of C-[GSK]-G-[GSPH]-A-[SLP]. {ECO:0000305} 507..541
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C42947925
eggNOG 1 0.900 E1_KOG2685
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2356
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D264325at33208
OrthoFinder 1 1.000 FOG0000438
OrthoInspector 1 1.000 T616116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19960
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.