DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32797 and PNRC2

Sequence 1:NP_726810.1 Gene:CG32797 FlyBaseID:FBgn0052797 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_060231.1 Gene:PNRC2 HGNCID:23158 Length:139 Species:Homo sapiens

Alignment Length:139 Identity:34/140 (24%)
Similarity:53/140 (38%) Gaps:35/140 (25%)


  Fly     4 ASASKESTKRSNQRQRQLQSQYQSTASKFKHQKSQQQQQGSSKGGGNNKRRNRAGRWHQGARQLR 68
            |..|:..:|...|..|| :::.|::..|..|:|.:       :|.|.|   :.|..|.       
Human    11 APQSRNVSKNQQQLNRQ-KTKEQNSQMKIVHKKKE-------RGHGYN---SSAAAWQ------- 57

  Fly    69 QSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSSLTHFAVSKCFLAPPPT 133
                .:.|||.........|   ..||..|.::..:.|..|          ::|.:|....|.|:
Human    58 ----AMQNGGKNKNFPNNQS---WNSSLSGPRLLFKSQANQ----------NYAGAKFSEPPSPS 105

  Fly   134 ALPNPPEHW 142
            .||.||.||
Human   106 VLPKPPSHW 114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32797NP_726810.1 None
PNRC2NP_060231.1 PNRC 91..137 CDD:317732 11/35 (31%)
SH3-binding 99..105 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.