DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32797 and Pnrc2

DIOPT Version :9

Sequence 1:	NP_726810.1	Gene:	CG32797 / 318215	FlyBaseID:	FBgn0052797	Length:	202	Species:	Drosophila melanogaster
Sequence 2:	NP_080659.1	Gene:	Pnrc2 / 52830	MGIID:	106512	Length:	140	Species:	Mus musculus

Alignment Length:	140	Identity:	32/140 - (22%)
Similarity:	49/140 - (35%)	Gaps:	42/140 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 SKESTKRSNQRQRQLQSQYQSTASKFKHQKSQQQQQGSSKGGGNNKRRNRAGRW---HQGARQLR 68
            |:.::|...|:.||......|:.:|..|:|.:       :|.|.|.   .|..|   ..|.:...
Mouse    14 SRNASKNQEQQNRQKSKDQNSSQTKIAHKKKE-------RGHGYNP---AAAAWQAMQNGGKTKS 68

  Fly    69 QSPVTIWNGGF-CPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSSLTHFAVSKCFLAPPP 132
            .|..:.||.|. .|.::   .:.|...::.|.|.|.                         .|.|
Mouse    69 LSNNSNWNAGLSSPSLL---FKSQASQNYAGAKFSE-------------------------PPSP 105

  Fly   133 TALPNPPEHW 142
            :.||.||.||
Mouse   106 SVLPKPPSHW 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32797	NP_726810.1	None
Pnrc2	NP_080659.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..81		19/76 (25%)
		PNRC	94..112	CDD:373788	7/42 (17%)
		SH3-binding	100..106		2/30 (7%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR15405
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100