DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32797 and Pnrc1

Sequence 1:NP_726810.1 Gene:CG32797 FlyBaseID:FBgn0052797 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_775444.1 Gene:Pnrc1 RGDID:628753 Length:269 Species:Rattus norvegicus

Alignment Length:96 Identity:22/97 (23%)
Similarity:32/97 (33%) Gaps:30/97 (31%)


  Fly    53 RRNRAGRWHQGARQLRQSPVTIWNGGFCPGIVRGSSRKQRKSSWLGGKISAQHQIQQQHPRIPSS 117
            :||....|...|...|.                   :||.|.     .:.....|:..|.:..:.
  Rat   171 KRNENDFWQDSASSDRM-------------------QKQEKK-----PLKNTENIKNNHLKKSAF 211

  Fly   118 LT------HFAVSKCFLAPPPTALPNPPEHW 142
            ||      ::|.:|....|.|:.||.||.||
  Rat   212 LTEGSQKENYAGAKFSDPPSPSVLPKPPSHW 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32797NP_726810.1 None
Pnrc1NP_775444.1 PNRC 219..267 CDD:292009 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15405
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.