DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HIP and unc-45

DIOPT Version :10

Sequence 1:NP_570074.3 Gene:HIP / 318211 FlyBaseID:FBgn0260484 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_524796.1 Gene:unc-45 / 44910 FlyBaseID:FBgn0288846 Length:947 Species:Drosophila melanogaster


Alignment Length:178 Identity:50/178 - (28%)
Similarity:77/178 - (43%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 EEVEQASELRAQAASAYGQQKFDEAIALYTKAIELSPGN---ALFHAKRGQAFLKLKKPNACIRD 182
            |||..|...:.:...|:...:::||:..|.|||:....:   |:|:..|..|:|||.|....:.|
  Fly     8 EEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKLGKYENAVED 72

  Fly   183 CDVALE-LNSDLAAGYKFRGRARRLLGDFELAAHDLRQACKLDFDEETDEWLKEVTPNAKKIEQH 246
            |..:|: ...|..|.:: |.:|...|..||.|..|.....|.|...:|      |.|..:::  |
  Fly    73 CTESLKAAPGDPKALFR-RAQAYEALEKFEEAYKDATALFKADPGNKT------VQPMLQRL--H 128

  Fly   247 RLKQER--RQAERKIKERQR-----------DQRRA--------RKEQ 273
            .:.:||  |.|:...|.:|.           |:|||        .|||
  Fly   129 VVVEERSARNAKTSTKVKQMMDLTFDLATPIDKRRAAANNLVVLAKEQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HIPNP_570074.3 Hip_N 10..47 CDD:271228
TPR repeat 126..154 CDD:276809 7/27 (26%)
NlpI <139..269 CDD:443815 40/146 (27%)
TPR repeat 159..189 CDD:276809 11/33 (33%)
TPR repeat 194..222 CDD:276809 8/27 (30%)
STI1 299..336 CDD:128966
unc-45NP_524796.1 3a0801s09 7..>127 CDD:273380 36/125 (29%)
TPR repeat 16..41 CDD:276809 6/24 (25%)
TPR repeat 46..79 CDD:276809 11/32 (34%)
UNC45-central 351..494 CDD:432011
PLN03200 399..>700 CDD:215629
armadillo repeat 753..789 CDD:293788
armadillo repeat 795..826 CDD:293788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.