DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and YIL165C

DIOPT Version :10

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_012101.1 Gene:YIL165C / 854641 SGDID:S000001427 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:101 Identity:22/101 - (21%)
Similarity:38/101 - (37%) Gaps:26/101 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 IVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEPK------NSTF 179
            |:...|.|:|....|.....|.:.|      :|:.|..|.:::.    .|.|:..      |:..
Yeast    30 IIDQATGKRKLPGWPSADDNCINGG------SVIIDPYGEIIAG----PLLGQEGLLTAEINTDL 84

  Fly   180 LPELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQ 215
            :.| :.|:.|   ..||:...|:.      ||.|.:
Yeast    85 IAE-ARFDLD---PVGHYARGDVF------QLTVNE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 22/101 (22%)
Vanin_C 324..503 CDD:465946
YIL165CNP_012101.1 nitrilase <1..110 CDD:448250 22/99 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.