DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and NTA1

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_012596.3 Gene:NTA1 / 853525 SGDID:S000003823 Length:457 Species:Saccharomyces cerevisiae


Alignment Length:386 Identity:74/386 - (19%)
Similarity:130/386 - (33%) Gaps:122/386 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EIIQSQNATSTDIIVFPESTLNSAGSTTFVPNPEDQINPCLSDPNATYYEEFLVTLSCAARNASK 119
            ::.:|......|||:|||..|     |.:..:....|.|.::..:               ...|.
Yeast    46 KVTKSATYVKPDIILFPEFAL-----TGYSFHARKDILPYVTKKD---------------EGPSF 90

  Fly   120 YIVINLTEKQKCEDI---PEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYGEPKN--STF 179
            .:..:::||.:|..|   |||     .:...::|:.:|.:.||..:..|||..||....|  ...
Yeast    91 ELAKSISEKFQCYTIIGYPED-----DDEQKLYNSALVVNPQGEQIFNYRKTFLYDTEMNWDCEE 150

  Fly   180 LPE-LSTFETDFG------------------VTFGHFICFDILFYTPAHQLIVEQGITDFVYPAM 225
            .|| ..||..||.                  .:.|  ||.|:..|             .|:.|..
Yeast   151 NPEGFQTFPMDFSKCAKLSNEDSYNRDVTLKASIG--ICMDLSPY-------------KFMAPFN 200

  Fly   226 WFSQLPFLTVNGIFSSKAVQIQLGW---------SYANNVNLLAAGASD----------PIVGNS 271
            .|....|...|.:   :.:...:.|         ...:|.:||.|..:.          |:.|: 
Yeast   201 HFEFSSFCVDNNV---ELILCPMAWLNSTSITDKQTLHNNSLLEAAKNKIAFALKEQGLPLAGS- 261

  Fly   272 GSGIYHGRSGSLRSVMRQESGERSIYVARVPKYRAKRRMKRDLKRQVATSSSFNIKRDYLENFTS 336
             .|||..:.|..:...|..|.:.:      .:|       :|:.....::.::.|.|.:  .|..
Yeast   262 -QGIYQLKIGDSQRTPRVPSDDST------SEY-------KDMDEPDMSNVNYWILRFF--PFLY 310

  Fly   337 EELKIDAGKIGNLSQNLCHGGFCCHFDLAWRSLGKPSRNTSHYSYRVGIYEGWRNEKRLDV 397
            .:.:|:..|..:|.:::               |||......|..|:    :|...|..:|:
Yeast   311 FKSRINWFKNSSLIESI---------------LGKTRMPLDHEYYK----DGKHKEDTIDL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 61/316 (19%)
Vanin_C 324..503 CDD:408788 14/74 (19%)
NTA1NP_012596.3 ScNTA1_like 20..315 CDD:143590 63/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.