DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and Nit2

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_075664.1 Gene:Nit2 / 52633 MGIID:1261838 Length:276 Species:Mus musculus

Alignment Length:269 Identity:63/270 (23%)
Similarity:111/270 (41%) Gaps:63/270 (23%)


  Fly    33 YTAGVVEFEPSNELSDNLAGYLEIIQSQNATSTDIIVFPESTLNSAGSTTFVPNPEDQINPCLSD 97
            :...:::.:.|:..||||.....:::.......:|:..|| ..||...||:.|:..::|      
Mouse     4 FRLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPE-CFNSPYGTTYFPDYAEKI------ 61

  Fly    98 PNATYYEEFLVTLSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVV 162
            |.     |....||..|:.:|.|::..        .|||:      :...::||..||...|.::
Mouse    62 PG-----ESTQKLSEVAKESSIYLIGG--------SIPEE------DAGKLYNTCSVFGPDGSLL 107

  Fly   163 SRYRKVHLY-----GE---PKNSTFLP--ELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQGI 217
            .::||:||:     |:   .::.|..|  ..|||:|.: ...|..||:|:.|...| |:..::|.
Mouse   108 VKHRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPY-CKVGLGICYDMRFAELA-QIYAQRGC 170

  Fly   218 TDFVY---------PAMW---------FSQLPFLTVNGIFSSKAVQIQLGWSYANNVN-----LL 259
            ...||         ||.|         .:|:...|.:.....||..:  .|.::..|:     |.
Mouse   171 QLLVYPGAFNLTTGPAHWELLQRARAVDNQVYVATASPARDDKASYV--AWGHSTVVDPWGQVLT 233

  Fly   260 AAGASDPIV 268
            .||..:.|:
Mouse   234 KAGTEETIL 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 63/270 (23%)
Nit2NP_075664.1 nit 5..265 CDD:143596 63/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.