DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and vnn1

DIOPT Version :8

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:XP_004914646.1 Gene:vnn1 / 496642 XenbaseID:XB-GENE-961108 Length:488 Species:Xenopus tropicalis

Alignment Length:551 Identity:145/551 - (26%)
Similarity:220/551 - (39%) Gaps:126/551 - (22%)


  Fly    11 FCLALGLMLNLSQQASLFKRDFYTAGVVEFE---PSNELSD------------NLAGYLEIIQSQ 60
            ||..|.:..:..|...|   |.:||.|.|..   |.|.::.            |:....:.|:|.
 Frog     4 FCFLLFISFSAIQSHGL---DKFTAAVYEHAVILPENSITPVTADEALALMNRNIDILEKAIKSA 65

  Fly    61 NATSTDIIVFPESTLNS---AGSTTF-----VPNPEDQINPCLSDPNATYYEEFLVTLSCAARNA 117
            .:....|||.||..:..   ...|.:     :|:||....|| |||...........|||.|:..
 Frog    66 ASQGAHIIVTPEDGIYGWIFTRETMYPFLENIPHPEVNWIPC-SDPERFGRAPVQTRLSCIAKLN 129

  Fly   118 SKYIVINLTEKQKCEDIPEDTRPCASNGLNVFNTNVVFDRQGVVVSRYRKVHLYG-------EPK 175
            |.|:|.|:.:|:.|.   ..|..|..:|...:||.||||..|.:|:||.|.:|:.       .|:
 Frog   130 SIYVVANIGDKKPCN---ISTVGCPEDGHFYYNTAVVFDSDGRLVARYHKYNLFSFEGQFNVPPE 191

  Fly   176 NSTFLPELSTFETDFGVTFGHFICFDILFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTVNGIFS 240
                 ||:.||||.|| .||.|||||||||.||..|:|:..:...:||..|.:.||..|      
 Frog   192 -----PEMVTFETPFG-KFGIFICFDILFYKPAAALVVDHQVDTILYPTGWLNILPHFT------ 244

  Fly   241 SKAVQIQLGWSYANNVNLLAAGASDPIVGNSGSGIY---------------HGR------SGSLR 284
              |::|...|:....:|||||...:..:..:|||||               ||.      |...|
 Frog   245 --AIEIHSAWAMGMGINLLAANLHNTSMRMTGSGIYTPETPGPYYYNMDTEHGHLILSELSAHPR 307

  Fly   285 SVMRQESGERSIYVARVPKYRAKRRMKRDLKRQVATSSSFNIKRDYL--ENFTSEELKIDAGKIG 347
            :.....:...|:|...:.:|                |...|:.|.:|  :.||..||....|   
 Frog   308 NSSTFFTPNWSLYANSIGQY----------------SPGHNVFRGHLFSDEFTFTELTEPQG--- 353

  Fly   348 NLSQNLCHGGFCCHFDLAWRSLGKPSRNTSHYSYRVGIYEGWRNEKRLDVNYIRNCGVFTCSGNS 412
              :..||....|||  |.:..:.|.....    |.:|:::|...|:.  ..|::.|.:.......
 Frog   354 --NYTLCQKNLCCH--LTYTGMEKIIDEV----YVLGVFDGLHTEEA--KCYMQICTLLKYQITD 408

  Fly   413 IDDCGQLLPDIQRPLVTFTHVEIRVTYPQSREFLLFPDTLLDNLLPLEPKQFEWSQKRISEESHQ 477
            ::.||  || ::.....|.:..:...:..|   .:||:.||             |:..::....|
 Frog   409 LETCG--LP-VETASTKFNYFSLSGNFSSS---FVFPEVLL-------------SKINLAAGMFQ 454

  Fly   478 V----RFALRKSLEVKHLLTFGIYGNYYNNE 504
            |    |.....|:..:.||:..:.|..|:.:
 Frog   455 VLPDGRLTSLSSISQEPLLSASLIGRLYDKD 485

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 100/346 (29%)
vnn1XP_004914646.1 biotinidase_like 23..324 CDD:143591 97/318 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C25979574
eggNOG 1 0.900 E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1276751at2759
OrthoFinder 1 1.000 FOG0000996
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.