DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32751 and CG8132

DIOPT Version :9

Sequence 1:NP_001284927.1 Gene:CG32751 / 318189 FlyBaseID:FBgn0052751 Length:525 Species:Drosophila melanogaster
Sequence 2:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster


Alignment Length:267 Identity:67/267 - (25%)
Similarity:91/267 - (34%) Gaps:81/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 CLSDPNAT-YYEEFLVT---------LSCAARNASKYIVINLTEKQKCEDIPEDTRPCASNGLN- 147
            |.:.|..| |:.|:..|         ||..||....|||..        .|||       .|.| 
  Fly    49 CFNAPYGTKYFREYSETIPDGYTSQQLSNLARKHQVYIVGG--------TIPE-------LGEND 98

  Fly   148 -VFNTNVVFDRQGVVVSRYRKVHLYG-EPKNSTFLPELSTFE--TDF------GVTFGHFICFDI 202
             ::||..|:...|.:|:::||:||:. :.|......|..|..  .||      |...|..||:||
  Fly    99 AIYNTCTVWSPTGDLVAKHRKMHLFDIDVKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDI 163

  Fly   203 LFYTPAHQLIVEQGITDFVYPAMWFSQLPFLTVNGIFSSKAVQIQLGW-----SYANNVNLLAAG 262
            .|...| :|....|....:|||      .|....|         .|.|     |.||: |.|...
  Fly   164 RFEEMA-RLYRNAGCEMIIYPA------AFNMTTG---------PLHWELLQRSRAND-NQLFVV 211

  Fly   263 ASDPIVGNSGSGIYHGRS---GSLRSVMRQESGERSIYVA--------------------RVPKY 304
            .:.|....|...:.:|.|   .....|.:..|....|.||                    |:..|
  Fly   212 TTSPARDTSAEYVAYGHSMVVNPWAKVQQSASEGEEIVVADIDFSEVEQVRQQIPVFGQRRLDLY 276

  Fly   305 RAKRRMK 311
            ..:|:.|
  Fly   277 ATERKAK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32751NP_001284927.1 biotinidase_like 33..329 CDD:143591 67/267 (25%)
Vanin_C 324..503 CDD:408788
CG8132NP_649888.1 nit 9..272 CDD:143596 63/254 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.